Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103700
Gene name
Locationscaffold_07:1555731..1557047
Strand-
Gene length (bp)1316
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain 1.0E-53 22 262
PF00734 CBM_1 Fungal cellulose binding domain 2.1E-06 308 330

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0030248 cellulose binding Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030247 polysaccharide binding No
GO:0030246 carbohydrate binding No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103700
MLSLTWAILSALTLSVNAGNKIWDGSFNPFTTATDFDKWDWSTPVGTYQWYIHGSQSTSRYLAVSSDYKNPAMSS
EQRGLKLTIDGTSNWNGQTLERTELIPQTSSNLGSGNLFYHFSVKRSSTNPPDSTLEHQVCFFESHFTELKYGVG
SNPTSLTWMISGAEQWNIPFDANTWFNFAYDIDVSKYSRSGNAVVNDRPIVKFSAGTVGLWASTGSDPLKKVVQN
RSAPTSTNSADWHLGVLRIVTNQTPEDWYFSGVYVENGPITTAIGSGGSPPSSSPPASTSPSTTQPTTTQAPTTT
TAGPTQTQWGQCGGVGWTGPTVCMYTSFTCID*
Coding >Agabi119p4|103700
ATGCTTTCACTCACTTGGGCTATACTTTCTGCCTTGACTCTCAGTGTCAACGCTGGTAACAAGATTTGGGATGGT
AGCTTCAATCCCTTCACTACCGCTACAGATTTTGATAAATGGGATTGGTCCACCCCTGTCGGTACCTATCAATGG
TACATCCATGGTAGTCAGTCTACCTCCCGGTACCTTGCCGTCTCTTCAGACTACAAGAACCCGGCCATGTCATCT
GAGCAGCGCGGGCTTAAGTTGACAATTGACGGCACCTCCAACTGGAATGGCCAAACCTTGGAGCGTACGGAATTG
ATTCCCCAGACAAGCTCCAACCTCGGCTCTGGCAATTTGTTCTACCACTTCTCTGTCAAGCGTTCTTCTACTAAT
CCCCCTGATTCAACTCTTGAACACCAAGTTTGCTTCTTCGAGAGCCATTTCACCGAGTTGAAATATGGCGTTGGC
TCGAACCCTACCAGCCTAACTTGGATGATCAGTGGTGCCGAACAATGGAATATCCCCTTCGACGCCAACACCTGG
TTCAACTTTGCCTATGATATTGATGTGAGTAAATATTCTCGAAGTGGTAATGCAGTTGTTAATGACCGCCCGATT
GTGAAGTTTTCTGCTGGAACTGTTGGACTCTGGGCTTCTACAGGCTCTGACCCGCTTAAAAAAGTCGTTCAAAAT
AGGAGCGCCCCAACGAGCACAAACTCGGCCGACTGGCATCTTGGTGTCCTTCGTATTGTGACTAACCAGACTCCT
GAAGACTGGTATTTCAGTGGTGTCTACGTCGAAAACGGTCCCATCACTACTGCTATCGGTAGTGGTGGCAGCCCA
CCATCCAGTAGCCCACCTGCTTCTACGTCGCCCTCCACCACACAGCCGACCACAACGCAAGCCCCTACTACCACA
ACTGCGGGACCTACACAAACCCAATGGGGTCAATGCGGGGGGGTAGGCTGGACTGGACCCACAGTCTGCATGTAT
ACCTCTTTCACGTGCATCGACTGA
Transcript >Agabi119p4|103700
ATGCTTTCACTCACTTGGGCTATACTTTCTGCCTTGACTCTCAGTGTCAACGCTGGTAACAAGATTTGGGATGGT
AGCTTCAATCCCTTCACTACCGCTACAGATTTTGATAAATGGGATTGGTCCACCCCTGTCGGTACCTATCAATGG
TACATCCATGGTAGTCAGTCTACCTCCCGGTACCTTGCCGTCTCTTCAGACTACAAGAACCCGGCCATGTCATCT
GAGCAGCGCGGGCTTAAGTTGACAATTGACGGCACCTCCAACTGGAATGGCCAAACCTTGGAGCGTACGGAATTG
ATTCCCCAGACAAGCTCCAACCTCGGCTCTGGCAATTTGTTCTACCACTTCTCTGTCAAGCGTTCTTCTACTAAT
CCCCCTGATTCAACTCTTGAACACCAAGTTTGCTTCTTCGAGAGCCATTTCACCGAGTTGAAATATGGCGTTGGC
TCGAACCCTACCAGCCTAACTTGGATGATCAGTGGTGCCGAACAATGGAATATCCCCTTCGACGCCAACACCTGG
TTCAACTTTGCCTATGATATTGATGTGAGTAAATATTCTCGAAGTGGTAATGCAGTTGTTAATGACCGCCCGATT
GTGAAGTTTTCTGCTGGAACTGTTGGACTCTGGGCTTCTACAGGCTCTGACCCGCTTAAAAAAGTCGTTCAAAAT
AGGAGCGCCCCAACGAGCACAAACTCGGCCGACTGGCATCTTGGTGTCCTTCGTATTGTGACTAACCAGACTCCT
GAAGACTGGTATTTCAGTGGTGTCTACGTCGAAAACGGTCCCATCACTACTGCTATCGGTAGTGGTGGCAGCCCA
CCATCCAGTAGCCCACCTGCTTCTACGTCGCCCTCCACCACACAGCCGACCACAACGCAAGCCCCTACTACCACA
ACTGCGGGACCTACACAAACCCAATGGGGTCAATGCGGGGGGGTAGGCTGGACTGGACCCACAGTCTGCATGTAT
ACCTCTTTCACGTGCATCGACTGA
Gene >Agabi119p4|103700
ATGCTTTCACTCACTTGGGCTATACTTTCTGCCTTGACTCTCAGTGTCAACGCTGGTAACAAGATTTGGGATGGT
AGCTTCAATCCCTTCACTACCGCTACAGATTTTGATAAATGTATGTATTTGCCTCCCCCACATCTGTTGTTCGAT
GTTCAATAGCTCCTAGGGGATTGGTCCACCCCTGTCGGTACCTATCAATGGGTGAGTTTGAAGGCGAATGTCAAA
CATACGGCCGACATTTTTACTAAAGGAACATCTTCTAGTACATCCATGGTAGTCAGTCTACCTCCCGGTACCTTG
CCGTCTCTTCAGACTACAAGAACCCGGCCATGTCATCTGAGCAGCGCGGGCTTAAGTTGACAATTGACGGCACCT
CCAACTGGAATGGCCAAACCTTGGAGCGTACGGAATTGATTCCCCAGACAAGCTCCAACCTCGGCTCTGGCAATT
TGTTCTACCACTTCTCTGTCAAGCGTTCTTCTACTAATCCCCCTGATGTACGTCCTTCGGAAAGATAACATAAAA
TTTGTACTGAGACTTTCTTTTGTAGTCAACTCTTGAACACCAAGTTTGCTTCTTCGAGAGCCATTTCACCGAGGT
ATGTCCTAGTTTTTTGCAGCCCTGAAAGTGCTAACGTTCCCAATCCAGTTGAAATATGGCGTTGGCTCGAACCCT
ACCAGCCTAACTTGGATGATCAGTGGTGCCGAACAATGGAATATCCCCTTCGACGCCAACACCTGGTTCAACTTT
GCCTATGATATTGATGTGAGTAAATATTCTCGAAGTGGTAATGCAGTTGTTAATGACCGCCCGATTGTGAAGTTT
TCTGCTGGAACTGTTGGACTCTGGGCTTCTACAGGCTCTGACCCGCTTAAAAAAGTCGTTCAAAATAGGAGCGCC
CCAACGAGCACAAACTCGGCCGACTGGCATCTTGGTGTCCTTCGTATTGTGACTAACCAGACTCCTGAAGACTGG
TATTTCAGTGGTGTCTACGTCGAAAACGGTCCCATCACTACTGCTATCGGTAGTGGTGGCAGCCCACCATCCAGT
AGCCCACCTGCTTCTACGTCGCCCTCCACCACACAGCCGACCACAACGCAAGCCCCTACTACCACAACTGCGGGA
CCTACACAAACCCAATGGGGTCAATGCGGGGGTATGTACATCAACCAAAAATTCACCGCCAAGAGGCTGACTTTC
ATTGCAGGGGTAGGCTGGACTGGACCCACAGTCTGTGCGAGCCCATACACTTGCACGCCCGTCTCTCCTCCTTAT
TACTCTCAGGCATGTATACCTCTTTCACGTGCATCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail