Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103650
Gene name
Locationscaffold_07:1540824..1542317
Strand-
Gene length (bp)1493
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 9.7E-13 32 306

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q94CH8|EXL1_ARATH GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana GN=EXL1 PE=2 SV=1 197 312 3.0E-06
sp|Q9FD10|SSEJ_SALTY Secreted effector protein SseJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sseJ PE=1 SV=1 54 315 6.0E-06

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103650
MFFKSLSALLFLSAFAASRPKHSFRWRDIEYVYVFGDSYSFVPGTSGLPSFSFIGDATRMAFTPEQLLSNEIIPK
NTSSGGSNWVEYLTGCYAGLPSSCPRQLWDFAHGGAVVSSKMLPARRNTTVQLEDQVQQWVDYAADVLPRPHGKT
LTLWWTGINDCTNICKNATITDIDSFIDADLELYFDAVENAARNKLRTHLFMNVPPIDLAPYGETVPGGEERLRT
TINTFNDKFAARAAKYARDHPEQLVMTFDAAAVFENILSHPHEYGFTNTSGVCELCQDHENYVWHNPHHPTEHVH
RVLAAAVEEYLSGPYL*
Coding >Agabi119p4|103650
ATGTTTTTTAAATCTCTCTCTGCGCTTCTATTTTTGTCTGCTTTCGCTGCCTCCCGTCCAAAACATAGTTTTCGA
TGGAGGGACATTGAATACGTCTATGTTTTCGGCGACTCATATTCATTTGTCCCTGGCACGTCTGGTTTACCATCC
TTTAGTTTCATTGGTGATGCTACAAGGATGGCTTTCACGCCCGAACAATTGCTTTCAAACGAGATTATTCCTAAA
AATACAAGCTCGGGCGGATCAAACTGGGTAGAGTACCTTACCGGGTGTTATGCGGGTCTACCGTCATCTTGTCCA
CGTCAATTGTGGGATTTCGCGCATGGAGGCGCTGTTGTTAGTAGTAAAATGCTGCCAGCCCGTCGGAACACCACG
GTTCAGCTTGAGGATCAAGTTCAGCAATGGGTAGATTATGCCGCCGATGTCCTTCCCAGACCGCACGGAAAGACC
TTAACTCTCTGGTGGACGGGAATCAACGACTGCACTAACATATGCAAGAACGCAACAATCACGGACATAGACTCG
TTCATTGATGCCGATCTGGAACTTTACTTCGATGCCGTCGAAAACGCCGCTCGAAATAAGCTTCGCACTCACTTG
TTCATGAATGTTCCTCCAATCGATTTAGCCCCCTATGGGGAAACGGTTCCGGGTGGAGAGGAACGACTGAGAACG
ACGATTAACACGTTTAACGACAAATTCGCCGCTCGCGCTGCTAAATATGCTAGAGACCATCCAGAGCAATTAGTA
ATGACCTTTGATGCTGCCGCTGTTTTCGAAAATATTCTTTCTCATCCACACGAATATGGTTTTACCAACACTTCA
GGTGTTTGCGAGTTATGCCAAGACCATGAGAACTATGTCTGGCACAATCCCCATCATCCAACGGAGCATGTACAT
AGGGTTTTGGCAGCAGCTGTTGAGGAGTATTTGAGTGGTCCATATTTGTAA
Transcript >Agabi119p4|103650
ATGTTTTTTAAATCTCTCTCTGCGCTTCTATTTTTGTCTGCTTTCGCTGCCTCCCGTCCAAAACATAGTTTTCGA
TGGAGGGACATTGAATACGTCTATGTTTTCGGCGACTCATATTCATTTGTCCCTGGCACGTCTGGTTTACCATCC
TTTAGTTTCATTGGTGATGCTACAAGGATGGCTTTCACGCCCGAACAATTGCTTTCAAACGAGATTATTCCTAAA
AATACAAGCTCGGGCGGATCAAACTGGGTAGAGTACCTTACCGGGTGTTATGCGGGTCTACCGTCATCTTGTCCA
CGTCAATTGTGGGATTTCGCGCATGGAGGCGCTGTTGTTAGTAGTAAAATGCTGCCAGCCCGTCGGAACACCACG
GTTCAGCTTGAGGATCAAGTTCAGCAATGGGTAGATTATGCCGCCGATGTCCTTCCCAGACCGCACGGAAAGACC
TTAACTCTCTGGTGGACGGGAATCAACGACTGCACTAACATATGCAAGAACGCAACAATCACGGACATAGACTCG
TTCATTGATGCCGATCTGGAACTTTACTTCGATGCCGTCGAAAACGCCGCTCGAAATAAGCTTCGCACTCACTTG
TTCATGAATGTTCCTCCAATCGATTTAGCCCCCTATGGGGAAACGGTTCCGGGTGGAGAGGAACGACTGAGAACG
ACGATTAACACGTTTAACGACAAATTCGCCGCTCGCGCTGCTAAATATGCTAGAGACCATCCAGAGCAATTAGTA
ATGACCTTTGATGCTGCCGCTGTTTTCGAAAATATTCTTTCTCATCCACACGAATATGGTTTTACCAACACTTCA
GGTGTTTGCGAGTTATGCCAAGACCATGAGAACTATGTCTGGCACAATCCCCATCATCCAACGGAGCATGTACAT
AGGGTTTTGGCAGCAGCTGTTGAGGAGTATTTGAGTGGTCCATATTTGTAA
Gene >Agabi119p4|103650
ATGTTTTTTAAATCTCTCTCTGCGCTTCTATTTTTGTCTGCTTTCGCTGCCTCCCGTCCAAAACATAGTTTTCGA
TGGAGGGACATTGAATACGTCTATGTTTTCGGCGACTCATATTCATTTGTCCCTGGCACGTCTGGTTTACCATCC
TTTAGGTTAGTAATGTTTGAAATCAGGTCAAAAAAAAAACCATTAATTATCCCGCTTAGTTTCATTGGTGATGCT
ACAAGGATGGCTTTCACGCCCGAACAATTGCTTTCAAACGAGATTATTCCTAAAAATGTATGAATAACGTCACCA
TATGCTTGGTATAATAGTAGTGAACGCTAACGTCGGCAGACAAGCTCGGGCGGATCAAACTGGGTAGGCGACCCT
GAAGACCCGTACCTTTATGCATTATCTGACACCCCAATAGGTAGAGTACCTTACCGGGTGTTATGCGGGTCTACC
GTCATCTTGTCCACGTCAATTGTGGGATTTCGCGCATGGAGGCGCTGTTGTTAGTAGTAAAATGTAGGTGTCGTT
TCATTTCCAGACCGTAACTCTGCCTCATCATCGGCTTGACGTGATAGGCTGCCAGCCCGTCGGAACACCACGGTT
CAGCTTGAGGATCAAGTTCAGCAATGGGTAGATTATGCCGCCGATGTCCTTCCCAGACCGCACGGAAAGACCTTA
ACTCTCTGGTGGACGGGAATCAACGACTGCACTAACATATGCAAGAACGCAACAGTTGGTTTCAGTTTTCTTGTC
AACTTTCTTTGAGATAACACATCGTTGCTCTCTAGATCACGGACATAGACTCGTTCATTGATGCCGATCTGGAAC
TTTACTTCGATGCCGTCGTATGTTTTTTTTTTCTTCAACATTTAAATCCACACTCTGATCCTTGTTATCAATCGA
TCTTTTTATCGTTATTCTAGGAAAACGCCGCTCGAAATAAGCTTCGCACTCACTTGTTCATGAATGTTCCTCCAA
TCGATTTAGCCCCCTATGGGGAAACGGTTCCGGGTGGAGAGGAACGACTGAGAACGACGATTAACACGTTTAACG
ACAAATTCGCCGCTCGCGCTGCTAAATATGCTAGAGACCATCCAGGTAATTTGGCTAGATATTATCCATCTTGGA
TAGAAACTGACCCCACGATGATCGGTGATCACAGAGCAATTAGTAATGACCTTTGATGCTGCCGCTGTTTTCGAA
AATATTCTTTCTCATCCACACGAATATGGTTTTACCAACACTTCAGGGTATGTTATTCATTTCAGACTCGCGGAA
AAAACTATCGTGAGATATTGAACGGAATAACAGTGTTTGCGAGTTATGCCAAGACCATGAGAACTATGTCTGGCA
CAGTGAGTTTATCTGTTTGTGGGACGTTCTGCGTGCAAAAATCTCATGTGGAAACAACCCTAGATCCCCATCATC
CAACGGAGCATGTACATAGGGTTTTGGCAGCAGCTGTTGAGGAGTATTTGAGTGGTCCATATTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail