Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103560
Gene name
Locationscaffold_07:1521006..1522127
Strand-
Gene length (bp)1121
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 7.9E-33 5 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94420|YQGD_SCHPO Probable phosphatase C1620.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.13 PE=3 SV=1 3 260 2.0E-16
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 3 176 3.0E-13
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 3 176 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94420|YQGD_SCHPO Probable phosphatase C1620.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.13 PE=3 SV=1 3 260 2.0E-16
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 3 176 3.0E-13
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|A9WW62|GPMA_BRUSI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|A9MCX8|GPMA_BRUC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|Q576R3|GPMA_BRUAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|Q2YJN6|GPMA_BRUA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain 2308) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|B2SC37|GPMA_BRUA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain S19) GN=gpmA PE=3 SV=1 3 176 3.0E-13
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 1 176 9.0E-13
sp|Q74L45|GPMA2_LACJO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gpmA2 PE=3 SV=1 1 176 5.0E-12
sp|A6WYJ2|GPMA_OCHA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gpmA PE=3 SV=1 3 176 6.0E-12
sp|Q98DM0|GPMA_RHILO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium loti (strain MAFF303099) GN=gpmA PE=3 SV=1 3 176 8.0E-12
sp|C3MBY8|GPMA_RHISN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium sp. (strain NGR234) GN=gpmA PE=3 SV=1 3 178 2.0E-11
sp|Q8RFG9|GPMA_FUSNN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gpmA PE=3 SV=1 2 177 2.0E-11
sp|B5ZWT2|GPMA_RHILW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gpmA PE=3 SV=1 3 176 3.0E-11
sp|B3PXK3|GPMA_RHIE6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CIAT 652) GN=gpmA PE=3 SV=1 3 176 4.0E-11
sp|A7IC75|GPMA_XANP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gpmA PE=3 SV=1 4 176 7.0E-11
sp|B6JCI9|GPMA_OLICO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gpmA PE=3 SV=1 4 178 7.0E-11
sp|O94461|YFFL_SCHPO Probable phosphatase C1687.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.21 PE=3 SV=1 1 172 8.0E-11
sp|Q88YY8|GPMA1_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA1 PE=3 SV=1 1 94 8.0E-11
sp|A1UTM4|GPMA_BARBK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gpmA PE=3 SV=1 3 176 1.0E-10
sp|B9JYQ2|GPMA_AGRVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gpmA PE=3 SV=1 3 176 1.0E-10
sp|A6UEW3|GPMA_SINMW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sinorhizobium medicae (strain WSM419) GN=gpmA PE=3 SV=1 3 176 2.0E-10
sp|B0UBD4|GPMA_METS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium sp. (strain 4-46) GN=gpmA PE=3 SV=1 4 176 2.0E-10
sp|P36623|PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpm1 PE=1 SV=1 4 176 2.0E-10
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 1 176 2.0E-10
sp|Q1MMY4|GPMA_RHIL3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gpmA PE=3 SV=1 3 176 3.0E-10
sp|A5E8K1|GPMA_BRASB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gpmA PE=3 SV=1 4 176 3.0E-10
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 3 176 3.0E-10
sp|B1M6A7|GPMA_METRJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gpmA PE=3 SV=1 4 176 4.0E-10
sp|C0QV47|GPMA_BRAHW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gpmA PE=3 SV=1 1 176 4.0E-10
sp|A6LUA1|GPMA_CLOB8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=gpmA PE=3 SV=1 1 176 5.0E-10
sp|B4SEI0|GPMA_PELPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gpmA PE=3 SV=1 1 176 6.0E-10
sp|Q92T25|GPMA_RHIME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium meliloti (strain 1021) GN=gpmA PE=3 SV=1 3 176 6.0E-10
sp|Q6FZ12|GPMA_BARQU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella quintana (strain Toulouse) GN=gpmA PE=3 SV=1 3 176 1.0E-09
sp|Q97FJ6|GPMA_CLOAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gpmA PE=3 SV=1 1 176 1.0E-09
sp|F4KI56|SERCL_ARATH Metal-independent phosphoserine phosphatase OS=Arabidopsis thaliana GN=IPSP PE=1 SV=1 1 200 1.0E-09
sp|B8D7J7|GPMA_BUCAT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=gpmA PE=3 SV=1 5 180 1.0E-09
sp|B8D995|GPMA_BUCA5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=gpmA PE=3 SV=1 5 180 1.0E-09
sp|A7HZ35|GPMA_PARL1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpmA PE=3 SV=1 4 176 2.0E-09
sp|B4U616|GPMA_HYDS0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=gpmA PE=3 SV=1 1 173 2.0E-09
sp|P57390|GPMA_BUCAI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gpmA PE=3 SV=1 5 180 2.0E-09
sp|A7GPN5|GPMA_BACCN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gpmA PE=3 SV=1 1 176 2.0E-09
sp|B6IYD3|GPMA_RHOCS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gpmA PE=3 SV=1 1 176 2.0E-09
sp|A4YJP8|GPMA_BRASO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain ORS278) GN=gpmA PE=3 SV=1 4 176 3.0E-09
sp|Q5HLI0|GPMA_STAEQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gpmA PE=3 SV=1 1 176 3.0E-09
sp|Q8CN61|GPMA_STAES 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gpmA PE=3 SV=1 1 176 3.0E-09
sp|B0B8U8|GPMA_CHLT2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gpmA PE=3 SV=1 1 176 4.0E-09
sp|Q9PLK4|GPMA_CHLMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gpmA PE=3 SV=1 1 176 4.0E-09
sp|Q8K9N1|GPMA_BUCAP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gpmA PE=3 SV=1 4 180 4.0E-09
sp|Q1QRT7|GPMA_NITHX 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gpmA PE=3 SV=1 4 176 5.0E-09
sp|B0BAH7|GPMA_CHLTB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gpmA PE=3 SV=1 1 176 5.0E-09
sp|A9IXE7|GPMA_BART1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gpmA PE=3 SV=1 3 176 5.0E-09
sp|Q5L4Y3|GPMA_CHLAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=gpmA PE=3 SV=1 1 173 6.0E-09
sp|Q821N6|GPMA_CHLCV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila caviae (strain GPIC) GN=gpmA PE=3 SV=1 1 173 6.0E-09
sp|B2IEV6|GPMA_BEII9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpmA PE=3 SV=1 4 176 7.0E-09
sp|B8EML2|GPMA_METSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gpmA PE=3 SV=1 4 176 8.0E-09
sp|B3QVL0|GPMA_CHLT3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gpmA PE=3 SV=1 1 176 1.0E-08
sp|Q2FTH0|GPMA_METHJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gpmA PE=3 SV=1 1 93 1.0E-08
sp|Q732Z5|GPMA2_BACC1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpmA2 PE=3 SV=1 1 176 1.0E-08
sp|B9J6R3|GPMA_AGRRK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=gpmA PE=3 SV=1 3 178 2.0E-08
sp|Q9Z743|GPMA_CHLPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia pneumoniae GN=gpmA PE=3 SV=1 1 176 2.0E-08
sp|O84727|GPMA_CHLTR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gpmA PE=3 SV=1 1 176 2.0E-08
sp|Q3KKX2|GPMA_CHLTA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gpmA PE=3 SV=1 1 176 2.0E-08
sp|Q256A6|GPMA_CHLFF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila felis (strain Fe/C-56) GN=gpmA PE=3 SV=1 1 173 3.0E-08
sp|A9VFW9|GPMA_BACWK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus weihenstephanensis (strain KBAB4) GN=gpmA PE=3 SV=1 1 176 4.0E-08
sp|B2SX15|GPMA_BURPP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gpmA PE=3 SV=1 1 176 4.0E-08
sp|Q63B92|GPMA_BACCZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain ZK / E33L) GN=gpmA PE=3 SV=1 1 176 5.0E-08
sp|Q8R7C8|GPMA_CALS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gpmA PE=3 SV=1 1 176 5.0E-08
sp|B9DL85|GPMA_STACT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus carnosus (strain TM300) GN=gpmA PE=3 SV=1 1 173 5.0E-08
sp|B1XS92|GPMA_POLNS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=gpmA PE=3 SV=1 1 176 5.0E-08
sp|A4JI45|GPMA_BURVG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gpmA PE=3 SV=1 1 176 6.0E-08
sp|Q38ZH8|GPMA1_LACSS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpmA1 PE=3 SV=1 1 93 6.0E-08
sp|Q07UT3|GPMA_RHOP5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisA53) GN=gpmA PE=3 SV=1 4 176 6.0E-08
sp|C1EUQ5|GPMA_BACC3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain 03BB102) GN=gpmA PE=3 SV=1 1 176 6.0E-08
sp|A0RE96|GPMA_BACAH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis (strain Al Hakam) GN=gpmA PE=3 SV=1 1 176 6.0E-08
sp|Q7ZVE3|TIGRB_DANRE Fructose-2,6-bisphosphatase TIGAR B OS=Danio rerio GN=tigarb PE=1 SV=2 1 137 8.0E-08
sp|Q47KS8|GPMA_THEFY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermobifida fusca (strain YX) GN=gpmA PE=3 SV=1 1 176 8.0E-08
sp|Q6HIL9|GPMA_BACHK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gpmA PE=3 SV=1 1 176 1.0E-07
sp|Q7VR80|GPMA_BLOFL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Blochmannia floridanus GN=gpmA PE=3 SV=1 1 182 1.0E-07
sp|A9W5P5|GPMA_METEP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium extorquens (strain PA1) GN=gpmA PE=3 SV=1 4 176 1.0E-07
sp|B7KNX9|GPMA_METC4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gpmA PE=3 SV=1 4 176 1.0E-07
sp|B1YNA6|GPMA_BURA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia ambifaria (strain MC40-6) GN=gpmA PE=3 SV=1 1 176 1.0E-07
sp|B1ZA86|GPMA_METPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gpmA PE=3 SV=1 4 176 1.0E-07
sp|Q21CH5|GPMA_RHOPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisB18) GN=gpmA PE=3 SV=1 4 176 1.0E-07
sp|Q0BBK5|GPMA_BURCM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gpmA PE=3 SV=1 1 176 1.0E-07
sp|B4EA64|GPMA_BURCJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gpmA PE=3 SV=1 1 176 1.0E-07
sp|B1JZ61|GPMA_BURCC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia cenocepacia (strain MC0-3) GN=gpmA PE=3 SV=1 1 176 1.0E-07
sp|Q3B5J2|GPMA_CHLL7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gpmA PE=3 SV=1 1 176 1.0E-07
sp|Q39CN6|GPMA_BURL3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gpmA PE=3 SV=2 1 176 1.0E-07
sp|A8IGZ9|GPMA_AZOC5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gpmA PE=3 SV=1 4 178 1.0E-07
sp|A7I8A7|GPMA_METB6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanoregula boonei (strain 6A8) GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|B7JPK2|GPMA_BACC0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain AH820) GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|Q6KSL4|GPMA_BACAN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus anthracis GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|C3LIE5|GPMA_BACAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|C3PAW8|GPMA_BACAA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus anthracis (strain A0248) GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|A4T096|GPMA_POLSQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|Q0KET8|GPMA_CUPNH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|A1JRT1|GPMA_YERE8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|P82612|PMGY_CANAL Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPM1 PE=1 SV=3 1 176 2.0E-07
sp|B9J102|GPMA_BACCQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain Q1) GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|B7HS46|GPMA_BACC7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain AH187) GN=gpmA PE=3 SV=1 1 176 2.0E-07
sp|P39701|COBC_SALTY Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cobC PE=1 SV=3 6 182 2.0E-07
sp|D3DFG8|PSPA_HYDTT Phosphoserine phosphatase 1 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspA PE=1 SV=1 1 182 2.0E-07
sp|Q03KA9|GPMA_STRTD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gpmA PE=3 SV=1 1 173 3.0E-07
sp|Q8VVB5|GPMA_STRT2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gpmA PE=3 SV=1 1 173 3.0E-07
sp|Q5LZF1|GPMA_STRT1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gpmA PE=3 SV=1 1 173 3.0E-07
sp|B3EFK8|GPMA_CHLL2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gpmA PE=3 SV=1 1 176 3.0E-07
sp|Q7MXP1|GPMA_PORGI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=gpmA PE=3 SV=1 1 176 3.0E-07
sp|B2RHB7|GPMA_PORG3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=gpmA PE=3 SV=1 1 176 3.0E-07
sp|Q11CB5|GPMA_CHESB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chelativorans sp. (strain BNC1) GN=gpmA PE=3 SV=1 3 176 3.0E-07
sp|A3CLS0|GPMA_STRSV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus sanguinis (strain SK36) GN=gpmA PE=3 SV=1 1 95 3.0E-07
sp|Q0RS35|GPMA_FRAAA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Frankia alni (strain ACN14a) GN=gpmA PE=3 SV=1 1 176 3.0E-07
sp|C1CFM7|GPMA_STRZJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain JJA) GN=gpmA PE=3 SV=1 1 94 3.0E-07
sp|P0A3Y4|GPMA_STRR6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gpmA PE=3 SV=1 1 94 3.0E-07
sp|P0A3Y3|GPMA_STRPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gpmA PE=3 SV=1 1 94 3.0E-07
sp|B1I720|GPMA_STRPI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gpmA PE=3 SV=1 1 94 3.0E-07
sp|C1C8P5|GPMA_STRP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain 70585) GN=gpmA PE=3 SV=1 1 94 3.0E-07
sp|B5E706|GPMA_STRP4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gpmA PE=3 SV=1 1 94 3.0E-07
sp|Q04JB4|GPMA_STRP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gpmA PE=3 SV=1 1 94 3.0E-07
sp|Q3SW71|GPMA_NITWN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gpmA PE=3 SV=1 4 176 3.0E-07
sp|B2S2B5|GPMA_TREPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gpmA PE=3 SV=1 2 173 4.0E-07
sp|P96121|GPMA_TREPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum (strain Nichols) GN=gpmA PE=3 SV=1 2 173 4.0E-07
sp|B1WAX6|TIGAR_XENTR Fructose-2,6-bisphosphatase TIGAR OS=Xenopus tropicalis GN=tigar PE=2 SV=1 6 191 4.0E-07
sp|Q8Y2I3|GPMA_RALSO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Ralstonia solanacearum (strain GMI1000) GN=gpmA PE=3 SV=2 1 176 4.0E-07
sp|C1CSS1|GPMA_STRZT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=gpmA PE=3 SV=1 1 94 5.0E-07
sp|C1CLZ5|GPMA_STRZP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain P1031) GN=gpmA PE=3 SV=1 1 94 5.0E-07
sp|B2IRR1|GPMA_STRPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain CGSP14) GN=gpmA PE=3 SV=1 1 94 5.0E-07
sp|B8ZM52|GPMA_STRPJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=gpmA PE=3 SV=1 1 94 5.0E-07
sp|B7IX37|GPMA_BACC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain G9842) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|Q30WZ8|GPMA_DESAG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Desulfovibrio alaskensis (strain G20) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|B1JSU1|GPMA_YERPY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|Q66D83|GPMA_YERPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|A4TNS2|GPMA_YERPP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis (strain Pestoides F) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|Q1CFN6|GPMA_YERPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|A9R3B3|GPMA_YERPG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|Q8ZGY5|GPMA_YERPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis GN=gpmA PE=3 SV=3 1 176 5.0E-07
sp|B2K8R3|GPMA_YERPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|Q1C964|GPMA_YERPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|A7FKP6|GPMA_YERP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|A1K9B9|GPMA_AZOSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azoarcus sp. (strain BH72) GN=gpmA PE=3 SV=1 1 176 5.0E-07
sp|A1WWH7|GPMA_HALHL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gpmA PE=3 SV=1 1 187 6.0E-07
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 6 177 6.0E-07
sp|Q6GE17|GPMA_STAAR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain MRSA252) GN=gpmA PE=3 SV=1 1 176 6.0E-07
sp|Q63XU7|GPMA_BURPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain K96243) GN=gpmA PE=3 SV=1 1 176 6.0E-07
sp|A3N5B0|GPMA_BURP6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain 668) GN=gpmA PE=3 SV=1 1 176 6.0E-07
sp|Q3JWH7|GPMA_BURP1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain 1710b) GN=gpmA PE=1 SV=1 1 176 6.0E-07
sp|A3NR09|GPMA_BURP0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain 1106a) GN=gpmA PE=3 SV=1 1 176 6.0E-07
sp|A1UZX9|GPMA_BURMS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain SAVP1) GN=gpmA PE=3 SV=1 1 176 6.0E-07
sp|Q62F43|GPMA_BURMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain ATCC 23344) GN=gpmA PE=3 SV=1 1 176 6.0E-07
sp|A2S625|GPMA_BURM9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain NCTC 10229) GN=gpmA PE=3 SV=1 1 176 6.0E-07
sp|A3MQ23|GPMA_BURM7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain NCTC 10247) GN=gpmA PE=3 SV=1 1 176 6.0E-07
sp|B9DUS6|GPMA_STRU0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gpmA PE=3 SV=1 1 192 7.0E-07
sp|B4RZM6|GPMA_ALTMD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=gpmA1 PE=3 SV=1 1 176 7.0E-07
sp|B2AGP7|GPMA_CUPTR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gpmA PE=3 SV=1 1 176 7.0E-07
sp|A8AW46|GPMA_STRGC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gpmA PE=3 SV=1 1 94 7.0E-07
sp|Q89WK1|GPMA_BRADU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gpmA PE=3 SV=1 4 176 8.0E-07
sp|B2JC95|GPMA_BURP8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gpmA PE=3 SV=1 1 176 8.0E-07
sp|Q81DD2|GPMA_BACCR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gpmA PE=3 SV=1 1 93 8.0E-07
sp|Q01YD0|GPMA_SOLUE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Solibacter usitatus (strain Ellin6076) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|A2SDN6|GPMA_METPP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylibium petroleiphilum (strain PM1) GN=gpmA PE=3 SV=1 1 93 9.0E-07
sp|P65709|GPMA_STAAW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain MW2) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|A8YYG4|GPMA_STAAT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|Q6G6Q5|GPMA_STAAS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain MSSA476) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|P99153|GPMA_STAAN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain N315) GN=gpmA PE=1 SV=1 1 176 9.0E-07
sp|P65708|GPMA_STAAM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|A6QJQ5|GPMA_STAAE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain Newman) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|Q5HDD9|GPMA_STAAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain COL) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|Q2YVZ6|GPMA_STAAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|A5IVJ6|GPMA_STAA9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain JH9) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|Q2FVK8|GPMA_STAA8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain NCTC 8325) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|Q2FE81|GPMA_STAA3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain USA300) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|A6U4E6|GPMA_STAA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain JH1) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|A7X656|GPMA_STAA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gpmA PE=3 SV=1 1 176 9.0E-07
sp|B7H7P4|GPMA_BACC4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain B4264) GN=gpmA PE=3 SV=1 1 93 1.0E-06
sp|Q38Z74|GPMA2_LACSS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpmA2 PE=3 SV=1 1 172 1.0E-06
sp|B8F5J4|GPMA_HAEPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=gpmA PE=3 SV=1 2 93 1.0E-06
sp|Q54NE6|PGAM_DICDI Probable phosphoglycerate mutase OS=Dictyostelium discoideum GN=gpmA PE=1 SV=1 4 176 1.0E-06
sp|Q3AU60|GPMA_CHLCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium chlorochromatii (strain CaD3) GN=gpmA PE=3 SV=1 1 176 1.0E-06
sp|Q83FQ7|GPMA_TROWT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Tropheryma whipplei (strain Twist) GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|Q83HD5|GPMA_TROW8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Tropheryma whipplei (strain TW08/27) GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|B4EST0|GPMA_PROMH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Proteus mirabilis (strain HI4320) GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|Q8E0G9|GPMA_STRA5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gpmA PE=3 SV=1 1 95 2.0E-06
sp|Q8E643|GPMA_STRA3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gpmA PE=3 SV=1 1 95 2.0E-06
sp|Q3K1U2|GPMA_STRA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gpmA PE=3 SV=1 1 95 2.0E-06
sp|Q476J7|GPMA_CUPPJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|B1GZZ1|GPMA_UNCTG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|A1KV25|GPMA_NEIMF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gpmA PE=3 SV=1 2 172 2.0E-06
sp|Q2T1H5|GPMA_BURTA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|A9M1A2|GPMA_NEIM0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gpmA PE=3 SV=1 2 172 2.0E-06
sp|Q9JYF7|GPMA_NEIMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gpmA PE=3 SV=1 2 172 2.0E-06
sp|B4S616|GPMA_PROA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|Q2YBZ1|GPMA1_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA1 PE=3 SV=1 1 176 2.0E-06
sp|B8GFF8|GPMA_METPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|Q9JTF2|GPMA_NEIMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gpmA PE=3 SV=1 2 172 2.0E-06
sp|A1BE55|GPMA_CHLPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|Q4L8T0|GPMA_STAHJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gpmA PE=3 SV=1 1 176 2.0E-06
sp|Q737X5|GPMA1_BACC1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpmA1 PE=3 SV=1 1 176 2.0E-06
sp|D3DFP8|PSPB_HYDTT Putative phosphoserine phosphatase 2 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspB PE=1 SV=1 1 168 2.0E-06
sp|Q9CKU9|GPMA_PASMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pasteurella multocida (strain Pm70) GN=gpmA PE=3 SV=1 2 93 2.0E-06
sp|A1VKR6|GPMA_POLNA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polaromonas naphthalenivorans (strain CJ2) GN=gpmA PE=3 SV=1 1 176 3.0E-06
sp|Q8A765|GPMA2_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA2 PE=3 SV=1 1 93 3.0E-06
sp|B0US27|GPMA_HISS2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Histophilus somni (strain 2336) GN=gpmA PE=3 SV=1 2 93 3.0E-06
sp|Q0I4D8|GPMA_HAES1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus somnus (strain 129Pt) GN=gpmA PE=3 SV=1 2 93 3.0E-06
sp|Q21YW0|GPMA_RHOFT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gpmA PE=3 SV=1 1 176 3.0E-06
sp|B5EC38|GPMA_GEOBB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gpmA PE=3 SV=1 1 176 3.0E-06
sp|A1SP05|GPMA_NOCSJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=gpmA PE=3 SV=1 3 176 3.0E-06
sp|C6DCF6|GPMA_PECCP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gpmA PE=3 SV=1 1 176 3.0E-06
sp|Q9PC88|GPMA_XYLFA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xylella fastidiosa (strain 9a5c) GN=gpmA PE=3 SV=1 4 176 3.0E-06
sp|B0U2F2|GPMA_XYLFM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xylella fastidiosa (strain M12) GN=gpmA PE=3 SV=1 4 176 3.0E-06
sp|A5UDW8|GPMA_HAEIE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain PittEE) GN=gpmA PE=3 SV=1 2 93 3.0E-06
sp|Q4QME2|GPMA_HAEI8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain 86-028NP) GN=gpmA PE=3 SV=1 2 93 3.0E-06
sp|Q87CZ1|GPMA_XYLFT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gpmA PE=3 SV=1 4 176 4.0E-06
sp|B2I4U0|GPMA_XYLF2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xylella fastidiosa (strain M23) GN=gpmA PE=3 SV=1 4 176 4.0E-06
sp|Q6D7E3|GPMA_PECAS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gpmA PE=3 SV=1 1 176 4.0E-06
sp|B3DZZ7|GPMA_METI4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylacidiphilum infernorum (isolate V4) GN=gpmA PE=3 SV=1 2 173 4.0E-06
sp|A5UHR1|GPMA_HAEIG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain PittGG) GN=gpmA PE=3 SV=1 2 93 4.0E-06
sp|B5Y7Q7|GPMA_COPPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gpmA PE=3 SV=1 1 176 4.0E-06
sp|Q1JQA7|TIGAR_BOVIN Fructose-2,6-bisphosphatase TIGAR OS=Bos taurus GN=TIGAR PE=2 SV=1 7 153 5.0E-06
sp|B4RIY7|GPMA_NEIG2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gpmA PE=3 SV=1 2 172 5.0E-06
sp|Q5F7C0|GPMA_NEIG1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gpmA PE=3 SV=1 2 172 5.0E-06
sp|Q7W1Q6|GPMA_BORPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gpmA PE=3 SV=1 1 176 5.0E-06
sp|Q7N6S0|GPMA_PHOLL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmA PE=3 SV=1 1 176 5.0E-06
sp|B3EN99|GPMA_CHLPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeobacteroides (strain BS1) GN=gpmA PE=3 SV=1 1 176 5.0E-06
sp|A7MIX7|GPMA_CROS8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmA PE=3 SV=1 1 176 5.0E-06
sp|Q7VL28|GPMA_HAEDU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gpmA PE=3 SV=1 2 93 5.0E-06
sp|B7GUR7|GPMA_BIFLS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=gpmA PE=3 SV=1 4 176 6.0E-06
sp|P59159|GPMA_BIFLO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain NCC 2705) GN=gpmA PE=3 SV=1 4 176 6.0E-06
sp|B3DQI6|GPMA_BIFLD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain DJO10A) GN=gpmA PE=3 SV=1 4 176 6.0E-06
sp|B0KBW9|GPMA_THEP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gpmA PE=3 SV=1 1 176 6.0E-06
sp|Q73M14|GPMA_TREDE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gpmA PE=3 SV=1 4 173 6.0E-06
sp|B0K4E2|GPMA_THEPX 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermoanaerobacter sp. (strain X514) GN=gpmA PE=3 SV=1 1 176 6.0E-06
sp|A4SDM0|GPMA_CHLPM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gpmA PE=3 SV=1 1 176 7.0E-06
sp|A9KN01|GPMA_CLOPH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gpmA PE=3 SV=1 2 176 7.0E-06
sp|C6E639|GPMA_GEOSM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter sp. (strain M21) GN=gpmA PE=3 SV=1 1 176 7.0E-06
sp|Q7VS43|GPMA_BORPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gpmA PE=3 SV=1 1 176 8.0E-06
sp|Q7WQN2|GPMA_BORBR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gpmA PE=3 SV=1 1 176 8.0E-06
sp|B0BPB3|GPMA_ACTPJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gpmA PE=3 SV=1 2 93 8.0E-06
sp|B3H1G9|GPMA_ACTP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gpmA PE=3 SV=1 2 93 8.0E-06
sp|A3N0J2|GPMA_ACTP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gpmA PE=3 SV=1 2 93 8.0E-06
sp|A4W369|GPMA_STRS2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus suis (strain 98HAH33) GN=gpmA PE=3 SV=1 1 93 8.0E-06
sp|Q82TU0|GPMA2_NITEU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gpmA2 PE=3 SV=1 1 176 9.0E-06
sp|P15259|PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens GN=PGAM2 PE=1 SV=3 4 176 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103560
MVTFLFIRHGESTDNTRALWAGWRDSPLTNYGMNQAKALGAAFVPIHFKAIHCSDLKRAFMTAQAIQVAQTIPKP
PLYSSILLREQHYGSAEGKGWHSARNPRLALEDHFEINSYPALHGRSERFPGGESLDDLAERAERVIDEILTPYI
VREDHEESCVAVASHGTFLSELIAALVRRDASLKATVQARDFRGMRNTGWTKVVVKRDVSQASDTNTVTVRFHVE
VVQINNWDHLLSLKRQRGGIRSSAYDPKQKDIRGFFKGQMGRM*
Coding >Agabi119p4|103560
ATGGTGACATTTCTATTCATCAGGCATGGTGAATCAACAGACAACACGCGTGCACTATGGGCTGGGTGGAGAGAT
TCACCTTTGACAAACTATGGCATGAACCAAGCGAAAGCGTTAGGCGCTGCGTTTGTGCCAATACATTTCAAGGCG
ATCCACTGTTCAGACCTGAAACGTGCATTCATGACCGCTCAAGCAATACAAGTTGCGCAAACGATTCCTAAACCT
CCACTTTATTCTTCTATACTTCTACGCGAACAACATTATGGTTCTGCGGAGGGAAAGGGATGGCATAGCGCACGA
AATCCGAGGCTGGCGCTAGAAGACCACTTTGAAATAAATTCATACCCAGCTTTACATGGACGATCGGAGCGATTT
CCAGGAGGCGAGAGTCTTGACGATTTAGCGGAACGGGCCGAAAGGGTGATCGACGAGATCCTAACACCATACATA
GTGCGGGAAGACCACGAAGAAAGCTGTGTAGCGGTTGCGAGCCATGGCACGTTTCTGAGTGAACTCATAGCGGCA
CTGGTGAGGAGAGATGCTAGTTTGAAGGCGACAGTTCAAGCTCGGGATTTTCGTGGAATGAGGAATACTGGGTGG
ACAAAGGTGGTGGTCAAGAGAGATGTAAGTCAAGCGTCCGATACCAACACTGTTACCGTTCGGTTTCATGTTGAG
GTTGTCCAAATTAATAATTGGGATCATCTCCTCTCCCTGAAGCGTCAAAGGGGTGGGATTAGAAGCTCTGCTTAT
GATCCAAAGCAAAAGGATATTCGAGGATTTTTCAAGGGACAAATGGGGCGAATGTAA
Transcript >Agabi119p4|103560
ATGGTGACATTTCTATTCATCAGGCATGGTGAATCAACAGACAACACGCGTGCACTATGGGCTGGGTGGAGAGAT
TCACCTTTGACAAACTATGGCATGAACCAAGCGAAAGCGTTAGGCGCTGCGTTTGTGCCAATACATTTCAAGGCG
ATCCACTGTTCAGACCTGAAACGTGCATTCATGACCGCTCAAGCAATACAAGTTGCGCAAACGATTCCTAAACCT
CCACTTTATTCTTCTATACTTCTACGCGAACAACATTATGGTTCTGCGGAGGGAAAGGGATGGCATAGCGCACGA
AATCCGAGGCTGGCGCTAGAAGACCACTTTGAAATAAATTCATACCCAGCTTTACATGGACGATCGGAGCGATTT
CCAGGAGGCGAGAGTCTTGACGATTTAGCGGAACGGGCCGAAAGGGTGATCGACGAGATCCTAACACCATACATA
GTGCGGGAAGACCACGAAGAAAGCTGTGTAGCGGTTGCGAGCCATGGCACGTTTCTGAGTGAACTCATAGCGGCA
CTGGTGAGGAGAGATGCTAGTTTGAAGGCGACAGTTCAAGCTCGGGATTTTCGTGGAATGAGGAATACTGGGTGG
ACAAAGGTGGTGGTCAAGAGAGATGTAAGTCAAGCGTCCGATACCAACACTGTTACCGTTCGGTTTCATGTTGAG
GTTGTCCAAATTAATAATTGGGATCATCTCCTCTCCCTGAAGCGTCAAAGGGGTGGGATTAGAAGCTCTGCTTAT
GATCCAAAGCAAAAGGATATTCGAGGATTTTTCAAGGGACAAATGGGGCGAATGTAA
Gene >Agabi119p4|103560
ATGGTGACATTTCTATTCGTGAGTGATTCATGTGCCATGCTAGTCTTGGTGCGCCGAGTCCTGATGACGTTCAGA
TCAGGCATGGTGAATCAACAGACAACACGGTTGGTCTTATGACTATAAATTGAACATAGGTTGAAGACCATTGCA
GCGTGCACTATGGGCTGGGTGGAGAGATTCACCTTTGACAAACTATGGTATGCCAACTGAGTAGTAGCAAAATGT
AAAGCTGGTCTGAGAGCTGACTTTTATCCAGGCATGAACGTAAGTTTTACGTGCAGAAAAATTCAGCCTATTATG
CTCAAATGTATCCAAGCAAGCGAAAGCGTTAGGCGCTGCGTTTGTGCCAATACATTTCAAGGCGATCCACTGTTC
AGACCTGAAACGTGCATTCATGACCGCTCAAGCAATACAAGTTGCGCAAACGATTCCTAAACCTCCACTTTATTC
TTCTATACTTCTACGCGAACAACATTATGGTTCTGCGGAGGGAAAGGGATGGCATAGCGCACGAAATCCGAGGCT
GGCGCTAGAAGACCACTTTGAAATAAATTCATACCCAGCTTTACATGGACGATCGGAGCGATTTCCAGGAGGCGA
GAGTCTTGACGATTTAGCGGAACGGGCCGAAAGGGTGATCGACGAGATCCTAACACCATACATAGTGCGGGAAGA
CCACGAAGAAAGCTGTGTAGCGGTTGCGAGCCATGGCACGTTTCTGAGTGAACTCATAGCGGCACTGGTGAGGAG
AGATGCTAGTTTGAAGGCGACAGTTCAAGCTCGGGATTTTCGTGGAATGAGGAATACTGGGTGGACAAAGGTGGT
GGTCGTGAGTAACGATTTTCTCCATAAGTCAGGATATCAACATTGCAGCAGAAGAGAGATGTAAGTCAAGCGTCC
GATACCAACACTGTTACCGTTCGGTTTCATGTTGAGGTTGTCCAAATTAATAATTGGGATCATCTCCTCTCCCTG
GTCCGTTTTCATATTTTTTTTTTCACCGAGACAAGAATTAACAGAACTGATAGAAGCGTCAAAGGGGTGGGATTA
GAAGCTCTGCTTATGATCCAAAGCAAAAGGATATTCGAGGATTTTTCAAGGGACAAATGGGGCGAATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail