Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103550
Gene name
Locationscaffold_07:1520540..1520961
Strand+
Gene length (bp)421
Transcript length (bp)252
Coding sequence length (bp)252
Protein length (aa) 84

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01632 Ribosomal_L35p Ribosomal protein L35 4.0E-16 30 78

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A8MI83|RL35_ALKOO 50S ribosomal protein L35 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpmI PE=3 SV=1 31 83 3.0E-06
sp|Q8R9C3|RL35_CALS4 50S ribosomal protein L35 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpmI PE=3 SV=1 28 81 4.0E-06
sp|B0K3V4|RL35_THEPX 50S ribosomal protein L35 OS=Thermoanaerobacter sp. (strain X514) GN=rpmI PE=3 SV=1 31 83 5.0E-06
sp|B0K8B4|RL35_THEP3 50S ribosomal protein L35 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpmI PE=3 SV=1 31 83 6.0E-06

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0009059 macromolecule biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043604 amide biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043603 cellular amide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0005198 structural molecule activity No
GO:1901566 organonitrogen compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103550
MLLSRVLSLGLRTGLGARLFSTTSAVEAGYKLKSHSGAKKRWKSLASGNSFKRDKAYHSHLAVSKSPARKNRLSK
TTVYIQID*
Coding >Agabi119p4|103550
ATGTTGCTGAGCCGGGTTCTCTCCTTGGGTCTGCGCACGGGGCTTGGTGCTCGGCTTTTCTCCACCACCTCCGCA
GTGGAAGCAGGCTACAAACTCAAATCGCACTCGGGTGCAAAAAAGAGGTGGAAATCTCTTGCTTCTGGCAACTCT
TTCAAACGAGACAAGGCCTATCACTCACACTTGGCCGTTTCAAAATCTCCGGCTCGCAAGAATCGCTTGTCAAAG
ACAACTGTATATATACAAATTGATTAA
Transcript >Agabi119p4|103550
ATGTTGCTGAGCCGGGTTCTCTCCTTGGGTCTGCGCACGGGGCTTGGTGCTCGGCTTTTCTCCACCACCTCCGCA
GTGGAAGCAGGCTACAAACTCAAATCGCACTCGGGTGCAAAAAAGAGGTGGAAATCTCTTGCTTCTGGCAACTCT
TTCAAACGAGACAAGGCCTATCACTCACACTTGGCCGTTTCAAAATCTCCGGCTCGCAAGAATCGCTTGTCAAAG
ACAACTGTATATATACAAATTGATTAA
Gene >Agabi119p4|103550
ATGTTGCTGAGCCGGGTTCTCTCCTTGGGTCTGCGCACGGGGCTTGGTGCTCGGCTTTTCTCCACCACCTCCGCA
GTGGAAGCAGGCTACAAACTCAAATCGCACTCGGGTGCAAAAAAGAGGTGGAAATCTCTTGCTTCTGGCAACTCT
TTCAAACGAGTCCGCAATTTCATTGAGTCTGCATGCACATTCTGACCTATCATCATCGTGTAGGACAAGGCCTAT
CACTCACACTTGGCCGTTTCAAAATCTCCGGCTCGCAAGAATCGCTTGTCAAAGACAACGTATTCAACCCACACC
CAGACCATTACCTTGAAGAAGCTGCTGCCTTACGGTTCTAACTAGTGTATATATACAAGTATGCATCTCCACAGC
TATCTACCAAGTGCCTTGGTTCTAATTCCAGTACCAGATTGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail