Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103540
Gene name
Locationscaffold_07:1515979..1520424
Strand-
Gene length (bp)4445
Transcript length (bp)3327
Coding sequence length (bp)3327
Protein length (aa) 1109

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10408 Ufd2P_core Ubiquitin elongating factor core 7.6E-212 377 1006
PF04564 U-box U-box domain 8.9E-26 1022 1092

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE05|UFD2_SCHPO Ubiquitin conjugation factor E4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ufd2 PE=2 SV=1 14 1097 0.0E+00
sp|P54860|UFD2_YEAST E4 ubiquitin-protein ligase UFD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD2 PE=1 SV=3 112 1103 7.0E-134
sp|Q9ES00|UBE4B_MOUSE Ubiquitin conjugation factor E4 B OS=Mus musculus GN=Ube4b PE=1 SV=3 190 1093 2.0E-132
sp|O95155|UBE4B_HUMAN Ubiquitin conjugation factor E4 B OS=Homo sapiens GN=UBE4B PE=1 SV=1 190 1094 5.0E-131
sp|Q9LF41|UBE4_ARATH Probable ubiquitin conjugation factor E4 OS=Arabidopsis thaliana GN=PUB1 PE=2 SV=1 105 1096 4.0E-123
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE05|UFD2_SCHPO Ubiquitin conjugation factor E4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ufd2 PE=2 SV=1 14 1097 0.0E+00
sp|P54860|UFD2_YEAST E4 ubiquitin-protein ligase UFD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD2 PE=1 SV=3 112 1103 7.0E-134
sp|Q9ES00|UBE4B_MOUSE Ubiquitin conjugation factor E4 B OS=Mus musculus GN=Ube4b PE=1 SV=3 190 1093 2.0E-132
sp|O95155|UBE4B_HUMAN Ubiquitin conjugation factor E4 B OS=Homo sapiens GN=UBE4B PE=1 SV=1 190 1094 5.0E-131
sp|Q9LF41|UBE4_ARATH Probable ubiquitin conjugation factor E4 OS=Arabidopsis thaliana GN=PUB1 PE=2 SV=1 105 1096 4.0E-123
sp|Q09349|UBE4_CAEEL Probable ubiquitin conjugation factor E4 OS=Caenorhabditis elegans GN=ufd-2 PE=3 SV=1 437 1096 1.0E-79
sp|Q5R9G3|UBE4A_PONAB Ubiquitin conjugation factor E4 A OS=Pongo abelii GN=UBE4A PE=2 SV=2 342 1096 1.0E-74
sp|A5PKG6|UBE4A_BOVIN Ubiquitin conjugation factor E4 A OS=Bos taurus GN=UBE4A PE=2 SV=1 397 1096 2.0E-74
sp|Q14139|UBE4A_HUMAN Ubiquitin conjugation factor E4 A OS=Homo sapiens GN=UBE4A PE=1 SV=2 342 1096 5.0E-74
sp|Q6P7A2|UBE4A_RAT Ubiquitin conjugation factor E4 A OS=Rattus norvegicus GN=Ube4a PE=2 SV=1 397 1096 4.0E-72
sp|E9Q735|UBE4A_MOUSE Ubiquitin conjugation factor E4 A OS=Mus musculus GN=Ube4a PE=1 SV=1 397 1096 1.0E-62
[Show less]

GO

GO Term Description Terminal node
GO:0016567 protein ubiquitination Yes
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0034450 ubiquitin-ubiquitin ligase activity Yes
GO:0000151 ubiquitin ligase complex Yes
GO:0032991 protein-containing complex No
GO:0044265 cellular macromolecule catabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0019538 protein metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:1990234 transferase complex No
GO:0009056 catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0008152 metabolic process No
GO:0061630 ubiquitin protein ligase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006508 proteolysis No
GO:0009057 macromolecule catabolic process No
GO:0008150 biological_process No
GO:1902494 catalytic complex No
GO:0036211 protein modification process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0043412 macromolecule modification No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0032446 protein modification by small protein conjugation No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103540
MGDREPPAPTPQDDADRIRLKRLAKLQASQSLAPPSESSIKVEPATPSPKKTPTPTHTPKPTPTSAPAASPTTKK
PPVDAKKQASGSVIVPSAVKHKTIQKFDAATWESQTIQDILKVTLSKDVAEASGHEIVWLKSLQNELISDEIPTD
GLNMDLIDRLLIARLELNPQSMTDDLDYLPVLVSLPPITVFQYLVGSWKRLNSARSALIRKKYSPPETQQALGKL
EKLRELLISYAGLTIQEPDMFPQPEGRPVGPPELVAPLLSLSTLSAPLLSGPIVDPDTLDASNIEQFVQELARRF
QDEELEPVLGPVVKELLSHECLTRPEGLAGGDAGWRGVVSGLELLVTIKSVASMITCMPEFNPPEATAPTIETLS
LMGPLCRLGVFGNEWPAIAKTYFTDTDKRARRDMESAFASLRGTLKSLQSSLFHIFNGLVRSSPEAREAVLQYFA
RVILLNNKRAGTHVDPATVASDSFMFNLQSVLYNFANPFIDATYSKMDKIDPLFYIHSSRIDLSEETRIKSTSEE
ASQWAEANRNPQASAPNFISNIFYLCIAMSHYGYLKSIDTLKELTRHVDDSQKLLDTVTQNRSWVGTPQQARMEA
AIAARKVELDKLRSHMYAFHTGLLDPEFIFASINFTTFLSTWIINQVDPKKSHPKTIIQLPLPDEVPMAWRILPE
YIIEDVADFMLFSLQYTPEKWEMAGRTELLTFVLTFLTSTWYIKNPFLKSKINDVLFFGTWGYGRERNGLLGNIL
NSDKLALTHLIPALTHFYIEVEQTGASSQFYDKFNARRSIAHVLKTVWSNPVHRAAVIREADNVDKFVRFVNLMM
NDVTYLLDESLNDITQIHTIENEMLDQAAWALQPVRQREEREGTLRGLERQASMYARLGATTVDLLKLFTAETKA
PFMMPEVVDRLAAMLDYNLSALAGPKCQELKVRNPERLGWEPRNLLRDIIDIFLNLSTQEEFVRAVANDGRSYSK
ELFERAARIATGRSIKTETDIAPFRIFIQKTEEMKANMEADEDMGDIPEEFLDPLMFTLMRDPVRLPSSNTIVDR
ATIKSHLLSDTKDPFNRAPLSIEEVIPIPDLKERIDAFLIERHDKRTAAKLEAMDTSP*
Coding >Agabi119p4|103540
ATGGGTGATCGCGAGCCACCTGCACCAACCCCACAGGACGATGCGGACCGCATCAGGCTAAAACGTCTTGCCAAA
CTACAAGCATCACAATCATTAGCACCACCCTCTGAATCCTCGATTAAAGTCGAACCTGCCACTCCGAGCCCTAAG
AAAACACCCACACCGACGCACACTCCCAAGCCGACACCAACCAGCGCGCCCGCTGCTTCCCCTACAACAAAGAAA
CCGCCCGTAGATGCGAAAAAGCAGGCATCAGGATCAGTCATTGTTCCATCCGCTGTAAAGCACAAAACTATACAG
AAGTTTGACGCCGCCACCTGGGAGAGCCAGACTATACAGGATATCTTGAAGGTTACACTGAGCAAAGATGTAGCG
GAGGCTAGTGGACATGAAATCGTATGGCTTAAAAGCCTTCAGAACGAATTGATTTCAGATGAAATACCTACAGAT
GGGCTGAATATGGACCTAATTGACCGTCTCCTTATCGCTCGTTTAGAGCTGAATCCCCAGTCGATGACCGATGAC
CTTGACTACCTGCCGGTGCTTGTATCTCTACCCCCCATCACGGTCTTTCAATATCTTGTGGGAAGTTGGAAAAGG
CTGAATTCCGCGCGATCAGCTCTCATCAGGAAGAAATACTCACCACCAGAGACTCAGCAAGCACTAGGGAAGCTC
GAAAAGTTGCGCGAACTCCTTATCAGCTATGCAGGATTGACTATTCAAGAGCCCGATATGTTTCCTCAACCTGAA
GGGCGACCCGTTGGCCCACCTGAGCTCGTTGCTCCACTTCTTTCACTTTCCACTCTTTCAGCACCACTCCTTTCC
GGCCCAATCGTTGACCCGGACACGCTTGATGCCTCAAATATCGAACAATTTGTCCAGGAGCTTGCTCGGAGGTTC
CAGGATGAGGAGTTGGAACCTGTACTAGGGCCCGTTGTGAAAGAACTTTTATCCCATGAATGCCTAACCCGTCCC
GAGGGGCTGGCAGGGGGTGATGCAGGATGGCGCGGGGTTGTAAGCGGGCTGGAGTTATTGGTGACTATCAAAAGT
GTTGCCAGCATGATTACCTGCATGCCGGAATTCAACCCTCCAGAAGCAACTGCTCCTACGATCGAAACACTGTCG
TTGATGGGACCGCTGTGTCGGCTGGGCGTCTTCGGTAACGAGTGGCCGGCCATTGCGAAGACATATTTCACTGAT
ACAGATAAGAGAGCGCGTCGTGACATGGAATCCGCCTTTGCAAGTCTGAGGGGTACCTTGAAAAGTCTGCAGTCT
TCATTATTTCATATCTTCAATGGGCTTGTCAGATCATCTCCGGAAGCTCGCGAGGCCGTTTTACAGTACTTTGCC
CGGGTTATTCTTCTGAATAACAAACGTGCTGGAACTCATGTCGATCCGGCGACGGTTGCTTCGGATAGCTTCATG
TTTAATTTACAAAGTGTGCTATACAATTTTGCGAATCCCTTCATTGATGCTACGTATTCGAAAATGGATAAAATT
GATCCTCTCTTCTATATCCATAGTTCTCGGATTGATCTGAGCGAGGAAACAAGGATCAAATCCACTAGCGAGGAA
GCTTCCCAGTGGGCCGAGGCAAATAGGAACCCTCAAGCATCTGCACCCAACTTCATCTCGAACATATTTTACCTC
TGTATAGCCATGAGTCATTATGGCTATCTTAAATCTATAGATACTCTGAAGGAATTGACGAGACATGTTGATGAC
TCCCAAAAGCTACTCGACACTGTCACTCAAAATAGATCGTGGGTTGGGACACCCCAGCAAGCCCGCATGGAAGCG
GCGATCGCTGCGAGAAAGGTGGAACTGGATAAGTTGCGGTCGCATATGTATGCATTCCATACAGGACTTTTAGAT
CCTGAGTTCATATTCGCGTCAATCAACTTTACCACGTTTTTATCTACGTGGATAATCAATCAAGTGGACCCCAAA
AAATCTCACCCCAAAACGATCATCCAACTGCCGTTGCCAGATGAAGTACCAATGGCCTGGCGGATCCTCCCTGAA
TACATCATTGAAGATGTTGCCGATTTTATGTTGTTTTCACTACAATATACCCCTGAGAAATGGGAAATGGCAGGA
AGAACGGAACTCTTGACCTTTGTTTTGACTTTCCTAACTTCGACGTGGTACATCAAGAACCCATTCCTCAAATCG
AAGATTAATGATGTTTTGTTCTTTGGCACATGGGGTTATGGTCGGGAGCGCAACGGCCTGCTCGGCAACATACTG
AATTCGGACAAGTTGGCTTTGACGCATCTTATACCTGCTCTGACTCACTTCTATATCGAGGTGGAACAGACTGGG
GCCAGTTCTCAGTTTTATGATAAATTCAATGCCCGTCGTAGTATTGCTCACGTCCTCAAAACGGTCTGGAGTAAT
CCAGTCCACCGAGCAGCAGTAATACGGGAGGCAGATAATGTTGACAAGTTTGTTCGTTTCGTCAATCTCATGATG
AACGACGTCACGTATCTTCTCGATGAATCACTGAACGACATCACCCAAATCCATACAATTGAGAATGAAATGTTG
GATCAAGCTGCATGGGCTTTACAACCTGTCCGACAACGGGAGGAACGGGAGGGCACATTACGAGGTTTGGAAAGA
CAAGCCTCAATGTATGCCAGGCTTGGAGCGACAACGGTGGATCTCTTGAAGTTGTTCACTGCGGAGACTAAGGCG
CCTTTTATGATGCCCGAAGTTGTCGATCGACTGGCCGCCATGTTGGATTATAATTTGAGTGCTCTGGCGGGACCA
AAATGTCAAGAACTCAAGGTCCGCAATCCGGAGAGATTGGGATGGGAACCGAGGAATTTGTTGAGGGATATCATC
GACATTTTCTTGAATTTGAGCACCCAGGAAGAGTTTGTCAGGGCCGTAGCCAATGATGGACGAAGTTATAGTAAG
GAGTTGTTCGAGCGGGCTGCGAGGATTGCAACTGGGAGAAGTATCAAGACGGAAACAGACATAGCACCATTCAGG
ATATTCATTCAGAAGACGGAAGAAATGAAGGCTAATATGGAGGCTGACGAAGACATGGGTGATATTCCGGAAGAG
TTCTTAGATCCTCTCATGTTCACTCTGATGCGCGATCCTGTCAGGCTACCATCTTCCAATACAATTGTGGACCGA
GCAACGATCAAATCACATCTACTTTCTGATACTAAAGATCCATTCAACCGAGCTCCCTTGTCCATCGAGGAGGTC
ATTCCAATCCCCGATTTGAAGGAGAGAATTGATGCATTCCTCATTGAGAGACATGATAAAAGAACAGCGGCGAAA
TTGGAAGCTATGGACACTTCGCCATGA
Transcript >Agabi119p4|103540
ATGGGTGATCGCGAGCCACCTGCACCAACCCCACAGGACGATGCGGACCGCATCAGGCTAAAACGTCTTGCCAAA
CTACAAGCATCACAATCATTAGCACCACCCTCTGAATCCTCGATTAAAGTCGAACCTGCCACTCCGAGCCCTAAG
AAAACACCCACACCGACGCACACTCCCAAGCCGACACCAACCAGCGCGCCCGCTGCTTCCCCTACAACAAAGAAA
CCGCCCGTAGATGCGAAAAAGCAGGCATCAGGATCAGTCATTGTTCCATCCGCTGTAAAGCACAAAACTATACAG
AAGTTTGACGCCGCCACCTGGGAGAGCCAGACTATACAGGATATCTTGAAGGTTACACTGAGCAAAGATGTAGCG
GAGGCTAGTGGACATGAAATCGTATGGCTTAAAAGCCTTCAGAACGAATTGATTTCAGATGAAATACCTACAGAT
GGGCTGAATATGGACCTAATTGACCGTCTCCTTATCGCTCGTTTAGAGCTGAATCCCCAGTCGATGACCGATGAC
CTTGACTACCTGCCGGTGCTTGTATCTCTACCCCCCATCACGGTCTTTCAATATCTTGTGGGAAGTTGGAAAAGG
CTGAATTCCGCGCGATCAGCTCTCATCAGGAAGAAATACTCACCACCAGAGACTCAGCAAGCACTAGGGAAGCTC
GAAAAGTTGCGCGAACTCCTTATCAGCTATGCAGGATTGACTATTCAAGAGCCCGATATGTTTCCTCAACCTGAA
GGGCGACCCGTTGGCCCACCTGAGCTCGTTGCTCCACTTCTTTCACTTTCCACTCTTTCAGCACCACTCCTTTCC
GGCCCAATCGTTGACCCGGACACGCTTGATGCCTCAAATATCGAACAATTTGTCCAGGAGCTTGCTCGGAGGTTC
CAGGATGAGGAGTTGGAACCTGTACTAGGGCCCGTTGTGAAAGAACTTTTATCCCATGAATGCCTAACCCGTCCC
GAGGGGCTGGCAGGGGGTGATGCAGGATGGCGCGGGGTTGTAAGCGGGCTGGAGTTATTGGTGACTATCAAAAGT
GTTGCCAGCATGATTACCTGCATGCCGGAATTCAACCCTCCAGAAGCAACTGCTCCTACGATCGAAACACTGTCG
TTGATGGGACCGCTGTGTCGGCTGGGCGTCTTCGGTAACGAGTGGCCGGCCATTGCGAAGACATATTTCACTGAT
ACAGATAAGAGAGCGCGTCGTGACATGGAATCCGCCTTTGCAAGTCTGAGGGGTACCTTGAAAAGTCTGCAGTCT
TCATTATTTCATATCTTCAATGGGCTTGTCAGATCATCTCCGGAAGCTCGCGAGGCCGTTTTACAGTACTTTGCC
CGGGTTATTCTTCTGAATAACAAACGTGCTGGAACTCATGTCGATCCGGCGACGGTTGCTTCGGATAGCTTCATG
TTTAATTTACAAAGTGTGCTATACAATTTTGCGAATCCCTTCATTGATGCTACGTATTCGAAAATGGATAAAATT
GATCCTCTCTTCTATATCCATAGTTCTCGGATTGATCTGAGCGAGGAAACAAGGATCAAATCCACTAGCGAGGAA
GCTTCCCAGTGGGCCGAGGCAAATAGGAACCCTCAAGCATCTGCACCCAACTTCATCTCGAACATATTTTACCTC
TGTATAGCCATGAGTCATTATGGCTATCTTAAATCTATAGATACTCTGAAGGAATTGACGAGACATGTTGATGAC
TCCCAAAAGCTACTCGACACTGTCACTCAAAATAGATCGTGGGTTGGGACACCCCAGCAAGCCCGCATGGAAGCG
GCGATCGCTGCGAGAAAGGTGGAACTGGATAAGTTGCGGTCGCATATGTATGCATTCCATACAGGACTTTTAGAT
CCTGAGTTCATATTCGCGTCAATCAACTTTACCACGTTTTTATCTACGTGGATAATCAATCAAGTGGACCCCAAA
AAATCTCACCCCAAAACGATCATCCAACTGCCGTTGCCAGATGAAGTACCAATGGCCTGGCGGATCCTCCCTGAA
TACATCATTGAAGATGTTGCCGATTTTATGTTGTTTTCACTACAATATACCCCTGAGAAATGGGAAATGGCAGGA
AGAACGGAACTCTTGACCTTTGTTTTGACTTTCCTAACTTCGACGTGGTACATCAAGAACCCATTCCTCAAATCG
AAGATTAATGATGTTTTGTTCTTTGGCACATGGGGTTATGGTCGGGAGCGCAACGGCCTGCTCGGCAACATACTG
AATTCGGACAAGTTGGCTTTGACGCATCTTATACCTGCTCTGACTCACTTCTATATCGAGGTGGAACAGACTGGG
GCCAGTTCTCAGTTTTATGATAAATTCAATGCCCGTCGTAGTATTGCTCACGTCCTCAAAACGGTCTGGAGTAAT
CCAGTCCACCGAGCAGCAGTAATACGGGAGGCAGATAATGTTGACAAGTTTGTTCGTTTCGTCAATCTCATGATG
AACGACGTCACGTATCTTCTCGATGAATCACTGAACGACATCACCCAAATCCATACAATTGAGAATGAAATGTTG
GATCAAGCTGCATGGGCTTTACAACCTGTCCGACAACGGGAGGAACGGGAGGGCACATTACGAGGTTTGGAAAGA
CAAGCCTCAATGTATGCCAGGCTTGGAGCGACAACGGTGGATCTCTTGAAGTTGTTCACTGCGGAGACTAAGGCG
CCTTTTATGATGCCCGAAGTTGTCGATCGACTGGCCGCCATGTTGGATTATAATTTGAGTGCTCTGGCGGGACCA
AAATGTCAAGAACTCAAGGTCCGCAATCCGGAGAGATTGGGATGGGAACCGAGGAATTTGTTGAGGGATATCATC
GACATTTTCTTGAATTTGAGCACCCAGGAAGAGTTTGTCAGGGCCGTAGCCAATGATGGACGAAGTTATAGTAAG
GAGTTGTTCGAGCGGGCTGCGAGGATTGCAACTGGGAGAAGTATCAAGACGGAAACAGACATAGCACCATTCAGG
ATATTCATTCAGAAGACGGAAGAAATGAAGGCTAATATGGAGGCTGACGAAGACATGGGTGATATTCCGGAAGAG
TTCTTAGATCCTCTCATGTTCACTCTGATGCGCGATCCTGTCAGGCTACCATCTTCCAATACAATTGTGGACCGA
GCAACGATCAAATCACATCTACTTTCTGATACTAAAGATCCATTCAACCGAGCTCCCTTGTCCATCGAGGAGGTC
ATTCCAATCCCCGATTTGAAGGAGAGAATTGATGCATTCCTCATTGAGAGACATGATAAAAGAACAGCGGCGAAA
TTGGAAGCTATGGACACTTCGCCATGA
Gene >Agabi119p4|103540
ATGGGTGATCGCGAGCCACCTGCACCAACCCCACAGGACGATGCGGACCGCGTGAGTATTGTACCTCATGCAGCT
GCTATTCGTGCTCATTTTGCAATCCAGATCAGGCTAAAACGTCTTGCCAAACTACAAGCATCACAATCATTAGCA
CCACCCTCTGAATCCTCGATTAAAGTCGAACCTGCCACTCCGAGCCCTAAGAAAACACCCACACCGACGCACACT
CCCAAGCCGACACCAACCAGCGCGCCCGCTGCTTCCCCTACAACAAAGAAACCGCCCGTAGATGCGAAAAAGCAG
GCATCAGGATCAGTCATTGTTCCATCCGCTGTAAAGCACAAAACTATACAGAAGTTTGACGCCGCCACCTGGGAG
AGCCAGACTATACAGGATATCTTGAAGGTTACACTGAGCGTGAGTGGCTTCAGTCATGTGGAAGAGCTTTCATCG
TTATGTTGCTTCATAGAAAGATGTAGCGGAGGCTAGTGGACATGAAATCGTATGGCTTAAAAGCCTTCAGAACGA
ATTGATTTCAGATGAAATACGTGAGCTTCTTTGAATGTGGGATTAGACTGCATCTTGACTTCCTTGTAGCTACAG
ATGGGCTGAATATGGACCTAATTGACCGTCTCCTTATCGCTCGTTTAGAGCTGAATCCCCAGTCGATGACGTAAA
GTGCAAAAGTATACTCGACGATGCTTTGGTAGCTGATAGCGATTTTTCTAGCGATGACCTTGACTACCTGCCGGT
GCTTGTATCTCTACCCCCCATCACGGTCTTTCAATATCTTGTGGGAAGTTGGAAAAGGCTGAATTCCGCGCGATC
AGCTCTCATCAGGAAGGTTAGTCACCCCTTTGACCTATTCATTGCAAACCAAGGAATGTTGATGGCCACGGTTTA
GAAATACTCACCACCAGAGACTCAGCAAGCACTAGGGAAGCTCGAAAAGTTGCGCGAACTCCTTATCAGCTATGC
AGGATTGACTATTCAAGAGCCCGATATGTTTCCTCAACCTGAAGGGTTAGCGCATAGTCAGCGTCATTAGTGCTA
ATTCATTAACCTAAACTTCAGGCGACCCGTTGGCCCACCTGAGCTCGTTGCTCCACTTCTTTCACTTTCCACTCT
TTCAGCACCACTCCTTTCCGGCCCAATCGTTGACCCGGACACGCTTGATGCCTCAAATATCGAACAATTTGTCCA
GGAGCTTGCTCGGAGGTTCCAGGATGAGGAGTTGGAACCTGTACTAGGGCCCGTTGTGAAAGAACTTTTATCCCA
TGAATGCCTAACCCGTCCCGAGGGGCTGGCAGGGGGTGATGCAGGATGGCGCGGGGTTGTAAGCGGGCTGGAGTT
ATTGGTGACTATCAAAAGTGTTGCCAGCATGATTACCTGCATGCCGGAATTCAACCCTCCAGAAGCAACTGCTCC
TACGATCGAAACACTGTCGTTGATGGGACCGCTGTGTCGGCTGGGCGTCTTCGGTAACGAGTGGGTAAGAAAAAG
CTTCCTTAGTGATTTTCATCCATTCACTGTTGTCTCTAGCCGGCCATTGCGAAGACATATTTCACTGATACAGAT
AAGAGAGCGCGTCGTGACATGGAATCCGCCTTTGCAAGTCTGAGGGGTACCTTGAAAAGTCTGCAGGTGCGAATG
ACGCGCGCAATACTTGCATTTTGGCCTAATTACTTTTCCAGTCTTCATTATTTCATATCTTCAATGGGCTTGTCA
GATCATCTCCGGAAGCTCGCGAGGCCGTTTTACAGTACTTTGCCCGGGTTATTCTTCTGAATAACAAACGTGCTG
GAACTCATGTCAGTCACTATGCTCGTTCTGGGGGTTGTCCAATGGCTAATCATTCAACTCAGGTCGATCCGGCGA
CGGTTGCTTCGGATAGCTTCATGTTTAATTTACAAAGTGTGCTATACAATTTTGCGAATCCCTTCATTGATGCTA
CGTATTCGAAAGTCAATTTTTTTTCACTTTGATCGCAGGCTGGTGCTAATTACTCGGTATCTCAGATGGATAAAA
TTGATCCTCTCTTCTATATCCATAGTTCTCGGATTGATCTGAGCGAGGAAACAAGGATCAAATCCACTAGCGAGG
AAGCTTCCCAGTGGGCCGAGGCAAATAGGAACCCTCAAGGTAGAGAATCTTCTTACTAGTTTGTTCTGCTCGATT
CTCACCAAATGCACAGCATCTGCACCCAACTTCATCTCGAACATATTTTACCTCTGTATAGCCATGAGTCATTAT
GGCTATCTTAAATCTATAGATACTCTGAAGGAATTGACGAGACATGTTGATGACTCCCAAAAGCTACTCGACACT
GTCACTCAAAATAGATCGTGGGTTGGGGTATGGCGCTTTTTTTCCTTTGATCCCAATGTTACTCACTCAAAACCG
CTTCTAGACACCCCAGCAAGCCCGCATGGAAGCGGCGATCGCTGCGAGAAAGGTATTTTCATTGAGTCTCGAGAT
TTGAAGGAACCCTGACATGTTCTGTAGGTGGAACTGGATAAGTTGCGGTCGCATATGTATGCATTCCATACAGGA
CTTTTAGATCCTGAGTTCATATTCGCGTCAATCAACTTTACCACGTTTTTATCTACGTGGATAATCAATCAAGTG
GACCCCAAAAAATCTCACCCCAAAACGATCATCCAGTTGAGATTCATCTTAACATTAGTCTTGCCTTCATTTAAC
TCACGTAATGTGATAGACTGCCGTTGCCAGATGAAGTACCAATGGCCTGGCGGATCCTCCCTGAATACATCATTG
AAGATGTTGCCGATTTTATGTTGTTTTCACTACAGTGAGCACCTTACTTTTCAATGCCGTGCCAAAAGATAACAC
TTTGTAGATATACCCCTGAGAAATGGGAAATGGCAGGAAGAACGGAACTCTTGACCTTTGTTTTGACTTTCCTAA
CTTCGACGTGGTACATCAAGAACCCATTCCTCAAATCGAAGATTAATGATGTATAGCTTTCATCCATTATCTTTT
CTCCTTTGGATCATCTAATTTGTTCTACCAGGTTTTGTTCTTTGGCACATGGGGTTATGGTCGGGAGCGCAACGG
CCTGCTCGGCAACATACTGAATTCGGACAAGTTGGCTTTGACGCATCTTATACCTGCTCTGACTCACTTCTATAT
CGGTATATACACTCGCTTCTGCTGTCAAAACAAGGATATTGATCGTATTTTCAGAGGTGGAACAGACTGGGGCCA
GTTCTCAGTTTTATGATAAATTCAGTGAGCTGATAGCATATCTCTACGGTCTCGATTCCTGATGCCATCTACCAA
GATGCCCGTCGTAGTATTGCTCACGTCCTCAAAACGGTCTGGAGTAATCCAGTCCACCGAGCAGCAGTAATACGG
GAGGCAGAGTGAGTAATCCCATCGTTTGATATTATTGAGCTGACTATTTCCATTTCAAGTAATGTTGACAAGTTT
GTTCGTTTCGTCAATCTCATGATGAACGACGTCACGTATCTTCTCGATGAATCACTGAACGACATCACCCAAATC
CATACAATTGAGAATGAAATGTTGGATCAAGCTGCATGGGCTTTACAACCTGTCCGACAACGGGAGGAACGGGAG
GGCACATTACGAGGTTTGGAAAGACAAGCCTCAATGTATGCCAGGCTTGGAGCGACAACGGTGGATCTCTTGAAG
TTGTTCACTGCGGAGACTAAGGCGCCTTTTATGATGCCCGAAGTTGTCGATCGACTGGCCGCCATGTTGGATTAT
AATTTGAGTGCTCTGGCGGGACCAAAATGTCAAGAACTCAAGGTCCGCAATCCGGAGAGATTGGGATGGGAACCG
AGGAATTTGTTGAGGGATATCATCGACATTTTCTTGAATTTGAGCACCCAGGAAGAGTTTGTCAGGGCCGTAGCC
AATGATGGACGAAGTTATAGTAAGGAGTTGTTCGAGCGGGCTGCGAGGATTGCAACTGGGAGAAGTATCAAGACG
GAAACAGACATAGCACCATTCAGGATATTCATTCAGAAGACGGAAGAAATGAAGGCTAATATGGAGGCTGACGAA
GACATGGGTGATATTCCGGAAGAGTTCTTAGGTAAGTTCCTGTTGCATTCCCAGAAGTATTTAGTGTCTCATCTT
TATTTTTTTTGTCGTAGATCCTCTCATGTTCACTCTGATGCGCGATCCTGTCAGGCTACCATCTTCCAATACAAT
TGTGGACCGAGCAACGATCAAATCACATCTACTTTCTGATACTAAAGATCCATTCAACCGAGCTCCCTTGTCCAT
CGAGGAGGTCATTCCAAGTTCGTTTCTCTGTCTTGGTTTCAGGTAACGAATCTTTATACTCATTCATAATTTTAG
TCCCCGATTTGAAGGAGAGAATTGATGCATTCCTCATTGAGAGACATGATAAAAGAACAGCGGCGAAATTGGAAG
CTATGGACACTTCGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail