Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103340
Gene name
Locationscaffold_07:1472885..1474241
Strand-
Gene length (bp)1356
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.5E-25 38 247
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.1E-14 47 199
PF08659 KR KR domain 1.7E-07 41 157
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.6E-06 41 231

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 2 319 4.0E-47
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 34 310 6.0E-37
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 34 274 1.0E-36
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 18 310 4.0E-35
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 34 310 4.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 2 319 4.0E-47
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 34 310 6.0E-37
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 34 274 1.0E-36
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 18 310 4.0E-35
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 34 310 4.0E-35
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 28 318 2.0E-34
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 34 310 6.0E-34
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 16 311 7.0E-34
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 10 293 3.0E-33
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 10 319 6.0E-33
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 10 319 8.0E-33
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 10 319 2.0E-32
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 28 312 2.0E-31
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 32 310 3.0E-31
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 35 317 6.0E-31
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 32 310 9.0E-31
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 34 310 4.0E-30
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 18 319 2.0E-29
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 35 310 4.0E-29
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 35 317 9.0E-29
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 35 311 2.0E-28
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 5 311 8.0E-27
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 34 287 6.0E-25
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 34 249 9.0E-20
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 34 249 2.0E-19
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 33 319 3.0E-19
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 9 312 3.0E-18
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 41 244 2.0E-17
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 35 249 2.0E-16
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 41 312 2.0E-16
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 26 245 3.0E-16
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 28 274 1.0E-15
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 28 277 4.0E-15
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 39 312 1.0E-14
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 23 312 1.0E-14
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 35 312 2.0E-14
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 38 312 8.0E-14
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 40 272 4.0E-13
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 41 274 9.0E-13
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 35 320 1.0E-12
sp|Q59987|POR_SYNY3 Light-dependent protochlorophyllide reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=por PE=3 SV=2 41 249 3.0E-12
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 41 249 4.0E-12
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 35 219 8.0E-12
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 35 320 2.0E-11
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 34 226 4.0E-11
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 34 244 2.0E-10
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 34 244 2.0E-10
sp|Q5AV81|Y7799_EMENI Uncharacterized oxidoreductase AN7799 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7799 PE=1 SV=2 42 246 5.0E-10
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 34 244 5.0E-10
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 32 246 6.0E-10
sp|O13822|YEE6_SCHPO Uncharacterized oxidoreductase C19A8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.06 PE=3 SV=1 35 174 9.0E-10
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 35 257 1.0E-09
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 34 250 1.0E-09
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 34 250 1.0E-09
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 32 290 2.0E-09
sp|P56937|DHB7_HUMAN 3-keto-steroid reductase OS=Homo sapiens GN=HSD17B7 PE=1 SV=1 38 260 2.0E-09
sp|P72220|BPHB_PSEPU Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 35 300 2.0E-09
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 32 251 2.0E-09
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 32 251 2.0E-09
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 32 251 2.0E-09
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 35 204 2.0E-09
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 32 251 2.0E-09
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 32 251 2.0E-09
sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 35 257 2.0E-09
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 32 251 2.0E-09
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 32 251 2.0E-09
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 34 180 4.0E-09
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 38 250 4.0E-09
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 38 250 4.0E-09
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 32 246 6.0E-09
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 35 263 7.0E-09
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 35 257 9.0E-09
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 33 246 9.0E-09
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 34 244 1.0E-08
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 32 251 1.0E-08
sp|P50206|BPHB_PSES1 Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas sp. (strain KKS102) GN=bphB PE=3 SV=1 35 189 1.0E-08
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 34 250 1.0E-08
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 32 199 1.0E-08
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 35 246 2.0E-08
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 35 199 2.0E-08
sp|Q41578|PORA_WHEAT Protochlorophyllide reductase A, chloroplastic OS=Triticum aestivum GN=PORA PE=3 SV=1 94 277 2.0E-08
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 35 199 3.0E-08
sp|P13653|PORA_HORVU Protochlorophyllide reductase A, chloroplastic OS=Hordeum vulgare GN=PORA PE=1 SV=1 94 277 3.0E-08
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 35 179 3.0E-08
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 32 255 4.0E-08
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 39 161 5.0E-08
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 39 161 5.0E-08
sp|P47227|BPHB_BURXL Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=bphB PE=1 SV=1 35 211 5.0E-08
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 38 149 7.0E-08
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 35 199 8.0E-08
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 34 250 9.0E-08
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 32 179 1.0E-07
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 32 179 1.0E-07
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 38 149 1.0E-07
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 32 152 1.0E-07
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 13 204 1.0E-07
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 35 152 2.0E-07
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 33 161 2.0E-07
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 36 274 2.0E-07
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 34 244 2.0E-07
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 34 244 2.0E-07
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 38 147 3.0E-07
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 38 147 3.0E-07
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 35 199 3.0E-07
sp|Q9WV68|DECR2_MOUSE Peroxisomal 2,4-dienoyl-CoA reductase OS=Mus musculus GN=Decr2 PE=1 SV=1 33 155 3.0E-07
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 9 182 3.0E-07
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 35 152 4.0E-07
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 35 147 4.0E-07
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 32 251 4.0E-07
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 28 257 4.0E-07
sp|Q9Z2M4|DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase OS=Rattus norvegicus GN=Decr2 PE=2 SV=1 33 155 4.0E-07
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 34 190 5.0E-07
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 26 199 5.0E-07
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 35 246 5.0E-07
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 13 204 5.0E-07
sp|Q071N0|SALR_PAPSO Salutaridine reductase OS=Papaver somniferum GN=SALR PE=1 SV=1 38 125 5.0E-07
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 33 155 6.0E-07
sp|Q62904|DHB7_RAT 3-keto-steroid reductase OS=Rattus norvegicus GN=Hsd17b7 PE=1 SV=1 38 260 6.0E-07
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 34 180 6.0E-07
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 16 199 6.0E-07
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 34 244 7.0E-07
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 40 219 7.0E-07
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 35 199 7.0E-07
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 34 152 9.0E-07
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 33 134 9.0E-07
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 19 246 1.0E-06
sp|A5PJF6|HSDL1_BOVIN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 15 164 1.0E-06
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 33 155 1.0E-06
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 35 199 1.0E-06
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 24 199 1.0E-06
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 39 179 1.0E-06
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 39 179 1.0E-06
sp|Q5ZJG8|HSDL1_CHICK Hydroxysteroid dehydrogenase-like protein 1 OS=Gallus gallus GN=HSDL1 PE=2 SV=1 31 252 1.0E-06
sp|A4UHT7|SALR_PAPBR Salutaridine reductase OS=Papaver bracteatum GN=SALR PE=1 SV=1 38 125 2.0E-06
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 38 179 2.0E-06
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 38 179 2.0E-06
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 35 152 2.0E-06
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 35 211 2.0E-06
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 35 147 2.0E-06
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 37 284 2.0E-06
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 35 147 2.0E-06
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 34 157 2.0E-06
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 28 199 3.0E-06
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 24 192 3.0E-06
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 28 199 3.0E-06
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 15 182 3.0E-06
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 12 244 3.0E-06
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 35 147 3.0E-06
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 34 204 3.0E-06
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 20 215 3.0E-06
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 38 246 3.0E-06
sp|Q84ST4|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1 41 246 3.0E-06
sp|B2X050|MNR1_CAPAN (+)-neomenthol dehydrogenase OS=Capsicum annuum GN=MNR1 PE=1 SV=1 36 125 4.0E-06
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 35 272 4.0E-06
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 32 199 4.0E-06
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 29 179 4.0E-06
sp|Q23116|YWC4_CAEEL Uncharacterized oxidoreductase W01C9.4 OS=Caenorhabditis elegans GN=W01C9.4 PE=3 SV=1 35 155 5.0E-06
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 34 157 5.0E-06
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 38 274 5.0E-06
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 35 246 5.0E-06
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 35 246 5.0E-06
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 32 125 5.0E-06
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 35 252 6.0E-06
sp|O75828|CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 36 179 6.0E-06
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 35 251 6.0E-06
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 35 152 6.0E-06
sp|Q9M2E2|SDR1_ARATH (+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1 32 125 6.0E-06
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 35 211 6.0E-06
sp|Q10216|YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.08 PE=3 SV=1 35 289 6.0E-06
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 32 181 7.0E-06
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 41 262 7.0E-06
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 35 257 7.0E-06
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 32 247 8.0E-06
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 35 246 8.0E-06
sp|Q51576|Y3106_PSEAE Uncharacterized oxidoreductase PA3106 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3106 PE=3 SV=1 33 159 8.0E-06
sp|Q9HK58|RHAD_THEAC L-rhamnose 1-dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rhaD PE=1 SV=2 32 187 9.0E-06
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 35 199 9.0E-06
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 35 179 9.0E-06
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 35 246 9.0E-06
sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3 36 179 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103340
MGFLADLCAIDFVSSFTQTFFLPRATWTAEDMPDLSAKVAIVTGGNSGIGKEVAKALLAHNAKVYIGCRSKERAE
RAILDLKEATGKEAIFLPLDLASLGSVKDAAMQFANKEKELHLLINNAGVMFPPHSQLSEGYDTQFHTNVTGHWY
LTTLLLPVLLETVKHSPPKSVRVVHVSSVGHYGAKAQPLNFASFKDGVVRNRYFTHELYMQSKFGNIVVANEFHR
RYAEQGLVSISVNPGSINTELYRHFRVPLLPSLVLYPPKTGAITPLYAATAKDAGHYGGKYLFPWARTGKARPDT
DDPKLGKDLWTWLEEQVKDT*
Coding >Agabi119p4|103340
ATGGGCTTCCTGGCTGATCTCTGTGCCATTGATTTTGTGTCATCCTTTACGCAGACTTTCTTCCTTCCACGCGCA
ACATGGACTGCTGAAGACATGCCTGATCTCTCAGCTAAGGTCGCCATCGTCACCGGAGGAAATTCTGGCATCGGA
AAGGAAGTAGCCAAAGCTTTGTTGGCGCATAATGCCAAAGTGTATATCGGGTGTCGAAGTAAGGAACGAGCAGAA
CGCGCAATTCTAGATTTGAAGGAGGCAACGGGCAAGGAGGCTATCTTCCTCCCACTTGATTTGGCTAGCTTGGGA
AGCGTGAAAGATGCTGCGATGCAGTTTGCCAACAAAGAGAAGGAGCTGCACTTATTGATAAACAATGCTGGCGTC
ATGTTTCCTCCTCATTCTCAGCTTAGCGAAGGATATGACACCCAATTCCATACAAACGTGACCGGTCACTGGTAT
CTCACAACATTGCTGTTACCAGTCTTGCTTGAGACAGTCAAACATTCGCCACCCAAGAGCGTACGCGTCGTCCAC
GTCTCTTCCGTTGGTCACTACGGGGCGAAGGCTCAGCCATTGAATTTTGCTAGTTTCAAGGATGGAGTAGTGAGA
AATAGATATTTCACTCATGAGCTTTACATGCAGAGCAAGTTTGGTAATATCGTTGTGGCAAATGAATTCCACCGA
AGATATGCAGAACAAGGTCTGGTTTCCATTTCCGTAAATCCAGGAAGTATCAATACCGAGCTTTATCGTCATTTC
AGAGTTCCTCTCCTGCCAAGTCTCGTGCTTTACCCACCCAAAACCGGGGCTATCACACCACTTTATGCCGCGACG
GCGAAAGATGCTGGGCATTACGGTGGGAAGTACTTATTTCCGTGGGCAAGAACTGGAAAAGCTCGTCCCGACACT
GATGATCCAAAGCTTGGAAAAGACCTGTGGACCTGGTTGGAGGAGCAAGTCAAGGATACTTGA
Transcript >Agabi119p4|103340
ATGGGCTTCCTGGCTGATCTCTGTGCCATTGATTTTGTGTCATCCTTTACGCAGACTTTCTTCCTTCCACGCGCA
ACATGGACTGCTGAAGACATGCCTGATCTCTCAGCTAAGGTCGCCATCGTCACCGGAGGAAATTCTGGCATCGGA
AAGGAAGTAGCCAAAGCTTTGTTGGCGCATAATGCCAAAGTGTATATCGGGTGTCGAAGTAAGGAACGAGCAGAA
CGCGCAATTCTAGATTTGAAGGAGGCAACGGGCAAGGAGGCTATCTTCCTCCCACTTGATTTGGCTAGCTTGGGA
AGCGTGAAAGATGCTGCGATGCAGTTTGCCAACAAAGAGAAGGAGCTGCACTTATTGATAAACAATGCTGGCGTC
ATGTTTCCTCCTCATTCTCAGCTTAGCGAAGGATATGACACCCAATTCCATACAAACGTGACCGGTCACTGGTAT
CTCACAACATTGCTGTTACCAGTCTTGCTTGAGACAGTCAAACATTCGCCACCCAAGAGCGTACGCGTCGTCCAC
GTCTCTTCCGTTGGTCACTACGGGGCGAAGGCTCAGCCATTGAATTTTGCTAGTTTCAAGGATGGAGTAGTGAGA
AATAGATATTTCACTCATGAGCTTTACATGCAGAGCAAGTTTGGTAATATCGTTGTGGCAAATGAATTCCACCGA
AGATATGCAGAACAAGGTCTGGTTTCCATTTCCGTAAATCCAGGAAGTATCAATACCGAGCTTTATCGTCATTTC
AGAGTTCCTCTCCTGCCAAGTCTCGTGCTTTACCCACCCAAAACCGGGGCTATCACACCACTTTATGCCGCGACG
GCGAAAGATGCTGGGCATTACGGTGGGAAGTACTTATTTCCGTGGGCAAGAACTGGAAAAGCTCGTCCCGACACT
GATGATCCAAAGCTTGGAAAAGACCTGTGGACCTGGTTGGAGGAGCAAGTCAAGGATACTTGA
Gene >Agabi119p4|103340
ATGGGCTTCCTGGCTGATCTCTGTGCCATTGATTTTGTGTCATCCTTTACGCAGACTTTCTTCCTTCCACGCGCA
ACATGGACTGCTGAAGACATGCCTGATCTCTCAGCTAAGGTCGCCATCGTCACCGGAGGAAATTCTGGCATCGGA
AAGGAAGTAGCCAAAGTGTGTTTTCCGCTCCATTCTAGTTCTACTATGACGTGATTTTCAGGCTTTGTTGGCGCA
TAATGCCAAAGTGTATATCGGGTGTCGAAGTAAGGAACGAGCAGAACGCGCAATTCTAGATTTGAAGGAGGCAAC
GGGCAAGGAGGCTATCTTCCTCCCACTTGATTTGGCTAGCTTGGGAAGCGTGAAAGATGCTGCGATGCAGTTTGC
CAAGTGAGCCAAACGACGTTTTCGTCACCGCAGCTACGACTGAGTCCGCCATTTCTCGATTATAGCAAAGAGAAG
GAGCTGCACTTATTGATAAACAATGCGTTTGTTCATTTACTCTTCCTCTTCATTCAAAAATATTGACTCCACCAC
ATAGTGGCGTCATGTTTCCTCCTCATTCTCAGCTTAGCGAAGGATATGACACCCAATTCCATACAAACGTGACCG
GTGAGTAGTATCAAACTTGCTGGAATAATCCAGAAGTACTCATCACACCATAGGTCACTGGTATCTCACAACATT
GCTGTTACCAGTCTTGCTTGAGACAGTCAAACATTCGCCACCCAAGAGCGTACGCGTCGTCCACGTCTCTTCCGT
TGGTCACTACGGGGCGAAGGCTCAGCCATTGAATTTTGCTAGTTTCAAGGATGGAGTAGTGAGAAATAGATATTT
CACTCATGAGCTTTACATGCAGAGCAAGTTTGTAAGTAATTCTCAAGAGGAAGCTTATGGGTGACTGTTAATATC
TCCATATCATCTAGGGTAATATCGTTGTGGCAAATGAATTCCACCGAAGATATGCAGAACAAGGTCTGGTTTCCA
TTTCCGTAAATCCAGGTCAGTAAATCTTCCGAGCTTTCGGAATGTTTACTCATTGGTCACTAGGAAGTATCAATA
CCGAGCTTTATCGTCATTTCAGAGTTCCTCTCCTGCCAAGTCTCGTGCTTTACCCACCCAAAACCGGGGCTATCA
CACCACTTTATGCCGCGACGGCGAAAGATGCTGGGCATTACGGTGGGAAGGTGTGTTTTTGAAAAAACAACGTTG
CTCGGTTGTGCGTTATGAACATGGTCGGCCTAACCATTCCTCTTGCAGTACTTATTTCCGTGGGCAAGAACTGGA
AAAGCTCGTCCCGACACTGATGATCCAAAGCTTGGAAAAGACCTGTGGACCTGGTTGGAGGAGCAAGTCAAGGAT
ACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail