Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103010
Gene name
Locationscaffold_07:1384560..1387694
Strand-
Gene length (bp)3134
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06978 POP1 Ribonucleases P/MRP protein subunit POP1 2.5E-21 62 137
PF06978 POP1 Ribonucleases P/MRP protein subunit POP1 5.8E-26 131 212
PF08170 POPLD POPLD (NUC188) domain 6.0E-32 502 593

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q99575|POP1_HUMAN Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens GN=POP1 PE=1 SV=2 53 594 6.0E-75
sp|Q9UTA4|POPI_SCHPO Ribonucleases P/MRP protein subunit pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=3 SV=1 7 593 2.0E-60
sp|P41812|POP1_YEAST Ribonucleases P/MRP protein subunit POP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP1 PE=1 SV=1 147 787 8.0E-29
sp|Q11188|YPD9_CAEEL Uncharacterized protein C05D11.9 OS=Caenorhabditis elegans GN=C05D11.9 PE=4 SV=2 57 594 9.0E-28
sp|P41812|POP1_YEAST Ribonucleases P/MRP protein subunit POP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP1 PE=1 SV=1 8 120 9.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103010
MSHPGNKRKNGGDEMSGRDKKKLKMNAARTIPVQSVPMARGSGSGIIKGMSGLPSAIDVEKFAEARAYEIDAMEK
AMKNASGASTQRAWQALPRHLRRRAASHDVRRVPAKLRGKAKAEMDPPSKKVKSRKLPKAGKNKKISKTESFQKR
QRDKSWLETHLWHAKRMKMENMWGYRLAVQPTEKSYRPSHRASIQGSIIHDASYFATLELKGPQFILEYILGLIC
DLQGAGAGATRWVVGSRAFNTHLHKCDFYPFGCLGPATIIWRPSNTQNQGLLRPGPLQKNNEPSTDCVATTPDNK
TTRNLWLRVHPAIFEDVTVELKKAVSRALDRPRPPPEEFEVEIADLRGQVNAFEIMGPKSNQVLRGALDPISKDD
RNVFKQFWMSLSKTQSPSAIPRDMIIGASVIDPRLKFPPKNAHVEYKEESSIIYLSTELARSDIWEHDIRKTLSK
PRYTKKDIDDRRSKNLVPGTPLKPERQDDRVPILLIRRTLEAPDAESQSISGYTLLFPAGWSMAFWSSLIYTGTR
VGGQRERQTQAYEAGVPYFPRDFPSSLAYEKYADEREIEERDTWTRKPPAKRVNYQKLGVHSPWRADWEVVLGLK
EATSPFDTAEGEPEDLVSTQRDDRMDVDKKDAETGDGDKAGDTSMNLDEFEVKPWLFRGSEINRILATLQTDPAT
NLLKEVNKMRQKRDLEPLNSSINPDALLKHALINVRVTVFKEGVPEDMAMIYQVSDEEATNWERLVHTREDRGGP
SILQLANKRPPQEDIIGYVTTGHYSLSRGKGFAIGAVPLTKFLELRAQQSRLHPLQTVEGQTLLVKVRNINGQQC
RPAHLRTLEC*
Coding >Agabi119p4|103010
ATGTCACATCCAGGCAACAAGCGTAAGAACGGAGGCGACGAAATGTCGGGGCGCGACAAGAAGAAGCTAAAAATG
AACGCTGCAAGAACCATTCCTGTCCAGTCTGTTCCTATGGCGCGTGGTTCCGGGAGTGGTATTATAAAGGGGATG
AGTGGACTTCCAAGTGCTATAGACGTTGAGAAATTCGCTGAAGCAAGAGCTTATGAAATCGACGCCATGGAAAAA
GCCATGAAGAATGCTAGTGGTGCTTCGACTCAAAGAGCGTGGCAGGCCCTTCCAAGGCACCTACGCCGCAGAGCC
GCTAGTCACGACGTTCGTCGCGTCCCTGCTAAACTTCGGGGAAAGGCAAAAGCCGAGATGGATCCCCCAAGTAAG
AAAGTCAAAAGTCGAAAGCTTCCTAAGGCGGGCAAAAACAAGAAAATCAGTAAAACTGAATCCTTCCAAAAACGA
CAAAGAGATAAGTCTTGGCTAGAGACTCACTTGTGGCATGCGAAACGGATGAAGATGGAAAATATGTGGGGATAT
CGTCTAGCAGTACAACCGACAGAAAAATCCTACCGTCCCTCCCACCGTGCTTCTATCCAAGGATCAATCATCCAT
GACGCTTCATACTTTGCGACCCTCGAACTGAAAGGCCCACAATTTATTCTCGAATATATTCTTGGATTAATCTGT
GACCTTCAAGGCGCAGGTGCTGGCGCGACTCGCTGGGTCGTGGGTTCTCGTGCTTTTAATACTCACCTTCATAAA
TGCGATTTCTACCCTTTTGGCTGTCTTGGCCCAGCAACGATTATATGGCGTCCGTCGAATACTCAAAATCAGGGC
CTGTTACGGCCAGGCCCTTTACAAAAGAACAACGAGCCGTCAACCGATTGCGTAGCAACTACTCCTGATAATAAA
ACAACGAGAAATCTATGGTTGCGTGTGCATCCAGCCATATTTGAAGATGTCACTGTTGAATTGAAGAAGGCGGTT
TCCCGAGCCTTAGATCGCCCAAGACCCCCACCGGAAGAGTTCGAAGTTGAGATCGCAGATCTGAGAGGACAAGTC
AATGCATTTGAAATCATGGGTCCAAAGTCAAATCAGGTCTTGAGAGGTGCATTGGACCCGATTTCGAAAGATGAT
AGAAACGTCTTCAAGCAGTTTTGGATGTCTTTATCTAAAACGCAATCACCCAGTGCGATACCTCGCGACATGATC
ATCGGAGCCTCGGTTATCGATCCAAGGCTGAAATTTCCGCCCAAAAATGCCCACGTTGAGTACAAGGAGGAGTCA
TCAATAATCTACCTGAGCACTGAGCTTGCGAGGAGTGATATATGGGAGCACGATATTCGTAAAACACTATCCAAA
CCACGCTACACCAAGAAGGATATCGACGATCGACGTTCCAAGAACCTTGTTCCGGGTACCCCGTTAAAACCAGAA
CGCCAAGACGATCGTGTACCTATTCTCCTTATCAGACGCACACTCGAAGCGCCAGATGCAGAAAGCCAATCCATC
AGCGGATACACGCTCCTATTTCCCGCAGGATGGTCAATGGCGTTTTGGTCTTCTCTCATATATACTGGTACTCGT
GTTGGGGGACAACGCGAACGACAAACGCAAGCTTATGAAGCTGGTGTACCTTACTTTCCTCGTGATTTTCCTTCC
TCTCTTGCATATGAGAAGTATGCGGACGAAAGGGAGATCGAGGAAAGGGACACATGGACAAGGAAACCTCCTGCT
AAGAGGGTAAACTATCAAAAGCTTGGAGTGCATAGTCCGTGGCGGGCAGATTGGGAGGTTGTACTTGGATTGAAG
GAGGCGACGTCTCCTTTTGATACAGCGGAGGGAGAACCAGAAGATCTTGTGTCGACACAAAGGGATGATCGGATG
GATGTGGACAAGAAAGACGCTGAGACCGGTGATGGGGATAAGGCTGGTGATACCTCAATGAATCTTGACGAATTC
GAAGTCAAACCATGGCTCTTTCGAGGTTCCGAGATCAACAGGATTCTCGCTACATTACAGACGGACCCTGCCACC
AATCTCTTAAAAGAGGTCAACAAAATGCGACAGAAAAGGGATCTAGAACCATTGAATTCATCGATAAACCCAGAT
GCGTTACTCAAGCATGCCCTAATCAATGTCAGAGTCACTGTGTTCAAAGAAGGCGTGCCTGAAGATATGGCTATG
ATCTATCAAGTGTCTGATGAGGAGGCTACGAATTGGGAGCGATTGGTGCATACGCGCGAGGATAGAGGTGGTCCT
AGCATACTACAGCTGGCGAATAAGCGACCACCTCAAGAAGATATCATTGGTTATGTTACAACGGGCCACTACTCG
TTATCGAGAGGAAAAGGATTTGCAATAGGCGCGGTTCCCTTGACCAAATTTCTCGAATTACGAGCACAGCAAAGC
CGACTCCACCCTCTTCAAACTGTGGAAGGGCAAACGTTGCTTGTCAAGGTTCGAAACATCAACGGTCAACAATGT
CGTCCGGCACATCTCCGAACCCTAGAATGCTAA
Transcript >Agabi119p4|103010
ATGTCACATCCAGGCAACAAGCGTAAGAACGGAGGCGACGAAATGTCGGGGCGCGACAAGAAGAAGCTAAAAATG
AACGCTGCAAGAACCATTCCTGTCCAGTCTGTTCCTATGGCGCGTGGTTCCGGGAGTGGTATTATAAAGGGGATG
AGTGGACTTCCAAGTGCTATAGACGTTGAGAAATTCGCTGAAGCAAGAGCTTATGAAATCGACGCCATGGAAAAA
GCCATGAAGAATGCTAGTGGTGCTTCGACTCAAAGAGCGTGGCAGGCCCTTCCAAGGCACCTACGCCGCAGAGCC
GCTAGTCACGACGTTCGTCGCGTCCCTGCTAAACTTCGGGGAAAGGCAAAAGCCGAGATGGATCCCCCAAGTAAG
AAAGTCAAAAGTCGAAAGCTTCCTAAGGCGGGCAAAAACAAGAAAATCAGTAAAACTGAATCCTTCCAAAAACGA
CAAAGAGATAAGTCTTGGCTAGAGACTCACTTGTGGCATGCGAAACGGATGAAGATGGAAAATATGTGGGGATAT
CGTCTAGCAGTACAACCGACAGAAAAATCCTACCGTCCCTCCCACCGTGCTTCTATCCAAGGATCAATCATCCAT
GACGCTTCATACTTTGCGACCCTCGAACTGAAAGGCCCACAATTTATTCTCGAATATATTCTTGGATTAATCTGT
GACCTTCAAGGCGCAGGTGCTGGCGCGACTCGCTGGGTCGTGGGTTCTCGTGCTTTTAATACTCACCTTCATAAA
TGCGATTTCTACCCTTTTGGCTGTCTTGGCCCAGCAACGATTATATGGCGTCCGTCGAATACTCAAAATCAGGGC
CTGTTACGGCCAGGCCCTTTACAAAAGAACAACGAGCCGTCAACCGATTGCGTAGCAACTACTCCTGATAATAAA
ACAACGAGAAATCTATGGTTGCGTGTGCATCCAGCCATATTTGAAGATGTCACTGTTGAATTGAAGAAGGCGGTT
TCCCGAGCCTTAGATCGCCCAAGACCCCCACCGGAAGAGTTCGAAGTTGAGATCGCAGATCTGAGAGGACAAGTC
AATGCATTTGAAATCATGGGTCCAAAGTCAAATCAGGTCTTGAGAGGTGCATTGGACCCGATTTCGAAAGATGAT
AGAAACGTCTTCAAGCAGTTTTGGATGTCTTTATCTAAAACGCAATCACCCAGTGCGATACCTCGCGACATGATC
ATCGGAGCCTCGGTTATCGATCCAAGGCTGAAATTTCCGCCCAAAAATGCCCACGTTGAGTACAAGGAGGAGTCA
TCAATAATCTACCTGAGCACTGAGCTTGCGAGGAGTGATATATGGGAGCACGATATTCGTAAAACACTATCCAAA
CCACGCTACACCAAGAAGGATATCGACGATCGACGTTCCAAGAACCTTGTTCCGGGTACCCCGTTAAAACCAGAA
CGCCAAGACGATCGTGTACCTATTCTCCTTATCAGACGCACACTCGAAGCGCCAGATGCAGAAAGCCAATCCATC
AGCGGATACACGCTCCTATTTCCCGCAGGATGGTCAATGGCGTTTTGGTCTTCTCTCATATATACTGGTACTCGT
GTTGGGGGACAACGCGAACGACAAACGCAAGCTTATGAAGCTGGTGTACCTTACTTTCCTCGTGATTTTCCTTCC
TCTCTTGCATATGAGAAGTATGCGGACGAAAGGGAGATCGAGGAAAGGGACACATGGACAAGGAAACCTCCTGCT
AAGAGGGTAAACTATCAAAAGCTTGGAGTGCATAGTCCGTGGCGGGCAGATTGGGAGGTTGTACTTGGATTGAAG
GAGGCGACGTCTCCTTTTGATACAGCGGAGGGAGAACCAGAAGATCTTGTGTCGACACAAAGGGATGATCGGATG
GATGTGGACAAGAAAGACGCTGAGACCGGTGATGGGGATAAGGCTGGTGATACCTCAATGAATCTTGACGAATTC
GAAGTCAAACCATGGCTCTTTCGAGGTTCCGAGATCAACAGGATTCTCGCTACATTACAGACGGACCCTGCCACC
AATCTCTTAAAAGAGGTCAACAAAATGCGACAGAAAAGGGATCTAGAACCATTGAATTCATCGATAAACCCAGAT
GCGTTACTCAAGCATGCCCTAATCAATGTCAGAGTCACTGTGTTCAAAGAAGGCGTGCCTGAAGATATGGCTATG
ATCTATCAAGTGTCTGATGAGGAGGCTACGAATTGGGAGCGATTGGTGCATACGCGCGAGGATAGAGGTGGTCCT
AGCATACTACAGCTGGCGAATAAGCGACCACCTCAAGAAGATATCATTGGTTATGTTACAACGGGCCACTACTCG
TTATCGAGAGGAAAAGGATTTGCAATAGGCGCGGTTCCCTTGACCAAATTTCTCGAATTACGAGCACAGCAAAGC
CGACTCCACCCTCTTCAAACTGTGGAAGGGCAAACGTTGCTTGTCAAGGTTCGAAACATCAACGGTCAACAATGT
CGTCCGGCACATCTCCGAACCCTAGAATGCTAA
Gene >Agabi119p4|103010
ATGTCACATCCAGGCAACAAGCGTAAGAACGGAGGCGACGAAATGTCGGGGCGCGACAAGAAGAAGCTAAAAATG
AACGCTGCAAGAACCATTCCTGTCCAGTCTGTTCCTATGGCGCGTGGTTCCGGGAGTGGTATTATAAAGGGTATG
GACTATCTCAATAGTTTGACTAGTATTTGACGGTTTAATAAGGGATGAGTGGACTTCCAAGTGCTATAGACGTTG
AGAAATTCGCTGAAGTGTGTTTAATATCGAACTTTCCCCAAAGGCACTCAATAATCAATTAGTAGGCAAGAGCTT
ATGAAATCGACGCCATGGAAAAAGCCATGAAGAATGCTAGGTACTCAAGTTGAGTGGAATTGAGAGTTAAGCTGA
CCATCAATATCCTAGTGGTGCTTCGACTCAAAGAGCGTGGCAGGCCCTTCCAAGGCACCTACGCCGCAGAGCCGC
TAGTCACGACGTTCGTCGCGTCCCTGCTAAACTTCGGGGAAAGGCAAAAGCCGAGGCGAGCAATGCTGTCGAATG
GGTCATTTATTTCTCATTCACCATCGGATCTCTGTAGATGGATCCCCCAAGTAAGAAAGTCAAAAGTCGAAAGCT
TCCTAAGGCGGGCAAAAACAAGAAAATCAGTAAAACTGAATCCTTCCAAAAACGACAAAGTATGTTCAACTGTTT
TTCGATATGTTTAAAATTGACGTGAAACAATTCACAAGGAGATAAGTCTTGGCTAGAGACTCACTTGTGGCATGC
GAAACGGATGAAGATGGAAAATATGTGGGGATATCGTCTAGTGAGCTAACCTATATCATCTTCGAGCGTTCATTA
AACCTATCCCAGGCAGTACAACCGACAGAAAAATCCTACCGTCCCTCCCACCGTGCTTCTATCCAAGGATCAATC
ATCCATGACGCTTCATACTTTGCGACCCTCGAACTGAAAGGCCCACAATTTATTCTCGAATATATTCTTGGATTA
ATCTGTGACCTTCAAGGCGCAGGTGCTGGCGCGACTCGGTGCGTTTTAACTATTTTGATACCTTTATCACGCATA
CTCATCTTAAAATGCAGCTGGGTCGTGGGTTCTCGTGCTTTTAATACTCACCTTCATAAATGCGATTTCTACCCT
TTTGGCTGTCTTGGCCCAGCAACGATTATATGGCGTCCGTCGAATACTCAAAATCAGGGCCTGTTACGGCCAGGC
CCTTTACAAAAGAACAACGAGCCGTCAACCGATTGCGTAGCAACTACTCCTGATAATAAAACAACGAGAAATCTA
TGGTTGCGTGTGCATCCAGCCATATTTGAAGATGTCACTGTTGAATTGAAGAAGGCGGTTTCCCGAGCCTTAGAT
CGCCCAAGACCCCCACCGGAAGAGTTCGAAGTTGAGATCGCAGATCTGAGAGGACAAGTCAATGCATTTGAAATC
ATGGGTCCAAAGTCAAATCAGGTCTTGAGAGGTGCATTGGACCCGATTTCGAAAGATGATAGAAACGTCTTCAAG
CAGGTCTGTCTTCCTTTCAAGCCGGGGCGAGAAGTTTCTGATTCGTGGTTTAGTTTTGGATGTCTTTATCTAAAA
CGCAATCACCCAGTGCGATACCTCGCGACATGATCATCGGAGCCTCGGTTATCGATCCAAGGCTGAAGTAAGTCA
TACCCAGAAAGTCACCGTATGGATAATTCATCAATTCTTCACAGATTTCCGCCCAAAAATGCCCACGTTGAGTAC
AAGGAGGAGTCATCAATAATCTACCTGAGCACTGAGCTTGCGAGGAGTGATATATGGGAGCACGATATTCGTAAA
ACACTATCCAAACCACGCTACACCAAGAAGGATATCGACGATCGACGTTCCAAGGTCAGCAGTCAATCTCCCCTC
CCCCCATTCTGCCACTAATGTACAGTCAATAGAACCTTGTTCCGGGTACCCCGTTAAAACCAGAACGCCAAGACG
ATCGTGTACCTATTCTCCTTATCAGACGCACACTCGAAGCGCCAGATGCAGAAAGCCAATCCATCAGCGGATACA
CGCTCCTATTTCCCGCAGGATGGTCAATGGCGTTTTGGTCTTCTCTCATATATACTGGTACTCGTGTTGGGGGAC
AACGCGAACGACAAACGCAAGCTTATGAAGCTGGTGTACCTTACTTTCCTCGTGATTTTCCTTCCTCTCTTGCAT
ATGAGAAGTATGCGGACGAAAGGGAGATCGAGGAAAGGGACACATGGACAAGGAAACCTCCTGCTAAGAGGGTAA
ACTATCAAAAGCTTGGAGTGCATAGTCCGTGGCGGGCAGATTGGGAGGTTGTACTTGGATTGAAGGAGGCGACGT
CTCCTTTTGATACAGCGGAGGGAGAACCAGAAGATCTTGTGTCGACACAAAGGGATGATCGGATGGATGTGGACA
AGAAAGACGCTGAGACCGGTGATGGGGATAAGGCTGGTGATACCTCAATGAATCTTGACGAATTCGAAGTCAAAC
CATGGCTCTTTCGAGGTTCCGAGATCAACAGGATTCTCGCTACATTACAGACGGACCCTGCCACCAATCTCTTAA
AAGAGGTCAACAAAATGCGACAGAAAAGGGATCTAGAACCATTGAATTCATCGATAAACCCAGATGCGTTACTCA
AGCATGCCCTAATCAATGTCAGAGTCACTGTGTTCAAAGAAGGCGTGCCTGAAGATATGGCTATGATCTATCAAG
TGTCTGATGAGGAGGCTACGAATTGGGAGCGATTGGTGCATACGCGCGAGGATAGAGGTGGTCCTAGCATACTAC
AGGTTAGTCCATTTGCCAATTCTTCTCAGTTCCTTAGTAAGATGGTTTTGTATAGCTGGCGAATAAGCGACCACC
TCAAGAAGATATCATTGGTTATGTTACAACGGGCCACTACTCGTTATCGAGAGGAAAAGGATTTGCAATAGGCGC
GGTTCCCTTGACCAAATTTCTCGAATTACGAGCACAGCAAAGCCGGTATGTCTATACTGTCCGCAACCAAGTGGT
TTCCTTCATATATGTATCTATGATCTAGACTCCACCCTCTTCAAACTGTGGAAGGGCAAACGTTGCTTGTCAAGG
TTCGAAACATCAACGGTCAACAATGTCGTCCGGCACATCTCCGAACCCTAGAATGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail