Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|102770
Gene name
Locationscaffold_07:1334348..1335924
Strand+
Gene length (bp)1576
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 1.2E-11 43 200
PF13460 NAD_binding_10 NAD(P)H-binding 1.9E-10 47 170
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.4E-09 43 154
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 6.8E-10 45 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25284|NDUA9_NEUCR NADH-ubiquinone oxidoreductase 40 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo40 PE=1 SV=2 9 344 1.0E-85
sp|Q5BK63|NDUA9_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Rattus norvegicus GN=Ndufa9 PE=1 SV=2 27 337 1.0E-69
sp|Q0MQB3|NDUA9_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFA9 PE=2 SV=2 27 337 2.0E-69
sp|Q16795|NDUA9_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens GN=NDUFA9 PE=1 SV=2 27 337 5.0E-69
sp|Q0MQB4|NDUA9_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pan troglodytes GN=NDUFA9 PE=2 SV=1 27 337 1.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25284|NDUA9_NEUCR NADH-ubiquinone oxidoreductase 40 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo40 PE=1 SV=2 9 344 1.0E-85
sp|Q5BK63|NDUA9_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Rattus norvegicus GN=Ndufa9 PE=1 SV=2 27 337 1.0E-69
sp|Q0MQB3|NDUA9_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFA9 PE=2 SV=2 27 337 2.0E-69
sp|Q16795|NDUA9_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens GN=NDUFA9 PE=1 SV=2 27 337 5.0E-69
sp|Q0MQB4|NDUA9_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pan troglodytes GN=NDUFA9 PE=2 SV=1 27 337 1.0E-68
sp|P0CB82|NDUA9_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pongo pygmaeus GN=NDUFA9 PE=2 SV=1 27 337 3.0E-68
sp|P0CB81|NDUA9_PONAB NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pongo abelii GN=NDUFA9 PE=2 SV=1 27 337 3.0E-68
sp|P34943|NDUA9_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Bos taurus GN=NDUFA9 PE=1 SV=1 7 337 3.0E-66
sp|Q9DC69|NDUA9_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Mus musculus GN=Ndufa9 PE=1 SV=2 27 337 2.0E-63
sp|Q9SK66|NDUA9_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Arabidopsis thaliana GN=At2g20360 PE=1 SV=2 31 336 2.0E-53
sp|Q559Z0|NDUA9_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Dictyostelium discoideum GN=ndufa9 PE=3 SV=1 8 261 5.0E-49
sp|Q0DWQ7|CCB12_ORYSJ Cyclin-B1-2 OS=Oryza sativa subsp. japonica GN=CYCB1-2 PE=3 SV=1 146 284 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0008202 steroid metabolic process No
GO:0008152 metabolic process No
GO:0008610 lipid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016229 steroid dehydrogenase activity No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0009058 biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|102770
MLRLQRVSGVGKRTYHDLVNLPTQKPVISYGPPGYSAVSGHTVTVFGATGFLGRYLVSKLGKLGTQVIVPYRDED
DSRIFKPMGDLGQIVRMEWDIRSEQQIAECVRHSDIVFNLVGRDYETKNFKFGDVHIEGAERIAKVCAAEGVPRF
VQVSHLNASATSQSKFYQTKAEGEERVKAAFPTATVMRPGPMYGYEDRLLNNMAFWSIWWKLNQAETRIRPVHVF
DVAQALANQVANNVSGRTLSLPGPSTLTYEYLLDLISSVTLRPPSRAPMLPKPIALAAAKLAQSVWWPALSPDEV
IRRYIDDSDVPGDWEVVGVNPTEIESHAIKYLRRYRTAENYVRPAVIPPRPSAKAIVEEY*
Coding >Agabi119p4|102770
ATGCTACGCTTACAGCGCGTTTCTGGCGTTGGAAAGCGAACATACCATGACCTCGTTAATCTTCCAACTCAGAAA
CCAGTCATTTCTTATGGACCTCCTGGATATAGTGCTGTCTCTGGTCACACTGTTACAGTCTTTGGTGCAACTGGT
TTCCTAGGTAGATACCTCGTGTCTAAGCTTGGAAAACTAGGAACACAAGTGATTGTTCCCTACCGTGATGAAGAT
GATTCAAGAATTTTCAAGCCTATGGGTGATTTGGGTCAGATCGTTCGAATGGAGTGGGATATTCGCAGTGAGCAA
CAGATTGCAGAATGCGTTCGACATTCGGATATCGTCTTTAACCTCGTTGGCCGCGATTACGAGACAAAGAACTTT
AAATTTGGAGATGTCCATATAGAAGGTGCCGAGCGCATCGCGAAGGTTTGCGCAGCAGAGGGTGTCCCACGTTTC
GTTCAAGTCTCGCACTTGAATGCTTCTGCAACATCTCAATCGAAATTCTATCAGACTAAAGCAGAAGGTGAGGAG
CGGGTAAAAGCCGCTTTCCCAACTGCGACTGTCATGCGACCCGGCCCCATGTACGGCTATGAGGATAGATTACTA
AATAATATGGCATTTTGGTCTATCTGGTGGAAGCTCAACCAAGCGGAGACTAGAATACGCCCAGTCCATGTCTTC
GACGTCGCTCAAGCTCTTGCCAATCAAGTGGCGAATAACGTCTCTGGGCGCACGTTATCGCTACCGGGACCATCT
ACTCTCACGTACGAATACCTCCTCGACCTCATTTCTTCGGTGACTCTTCGGCCTCCTTCTCGGGCCCCCATGTTA
CCGAAGCCCATTGCACTGGCTGCAGCCAAATTAGCACAGAGTGTGTGGTGGCCTGCCCTCAGTCCCGATGAGGTT
ATTAGGCGTTATATCGACGATAGTGACGTTCCCGGTGACTGGGAAGTTGTCGGCGTAAATCCCACCGAAATTGAA
TCCCACGCCATCAAGTATTTGAGGCGCTACCGTACCGCAGAAAATTATGTTCGCCCTGCGGTGATTCCGCCGAGA
CCGTCCGCCAAAGCCATTGTAGAGGAATATTAG
Transcript >Agabi119p4|102770
ATGCTACGCTTACAGCGCGTTTCTGGCGTTGGAAAGCGAACATACCATGACCTCGTTAATCTTCCAACTCAGAAA
CCAGTCATTTCTTATGGACCTCCTGGATATAGTGCTGTCTCTGGTCACACTGTTACAGTCTTTGGTGCAACTGGT
TTCCTAGGTAGATACCTCGTGTCTAAGCTTGGAAAACTAGGAACACAAGTGATTGTTCCCTACCGTGATGAAGAT
GATTCAAGAATTTTCAAGCCTATGGGTGATTTGGGTCAGATCGTTCGAATGGAGTGGGATATTCGCAGTGAGCAA
CAGATTGCAGAATGCGTTCGACATTCGGATATCGTCTTTAACCTCGTTGGCCGCGATTACGAGACAAAGAACTTT
AAATTTGGAGATGTCCATATAGAAGGTGCCGAGCGCATCGCGAAGGTTTGCGCAGCAGAGGGTGTCCCACGTTTC
GTTCAAGTCTCGCACTTGAATGCTTCTGCAACATCTCAATCGAAATTCTATCAGACTAAAGCAGAAGGTGAGGAG
CGGGTAAAAGCCGCTTTCCCAACTGCGACTGTCATGCGACCCGGCCCCATGTACGGCTATGAGGATAGATTACTA
AATAATATGGCATTTTGGTCTATCTGGTGGAAGCTCAACCAAGCGGAGACTAGAATACGCCCAGTCCATGTCTTC
GACGTCGCTCAAGCTCTTGCCAATCAAGTGGCGAATAACGTCTCTGGGCGCACGTTATCGCTACCGGGACCATCT
ACTCTCACGTACGAATACCTCCTCGACCTCATTTCTTCGGTGACTCTTCGGCCTCCTTCTCGGGCCCCCATGTTA
CCGAAGCCCATTGCACTGGCTGCAGCCAAATTAGCACAGAGTGTGTGGTGGCCTGCCCTCAGTCCCGATGAGGTT
ATTAGGCGTTATATCGACGATAGTGACGTTCCCGGTGACTGGGAAGTTGTCGGCGTAAATCCCACCGAAATTGAA
TCCCACGCCATCAAGTATTTGAGGCGCTACCGTACCGCAGAAAATTATGTTCGCCCTGCGGTGATTCCGCCGAGA
CCGTCCGCCAAAGCCATTGTAGAGGAATATTAG
Gene >Agabi119p4|102770
ATGCTACGCTTACAGCGCGTTTCTGGCGTTGGAAAGGTTCGTCTTTATTTTTCTCTACACGAGGCTAAATGGCTC
ATCCCAATCCCGACAGCGAACATACCATGACCTCGTTAATCTTCCAACTCAGAAACCAGTCATTTCTTATGGACC
TCCTGGATATAGTGCTGTCTCTGGTCACACTGTTACAGTCTTTGGTGCAACTGGTTTCCTAGGTAGATACCTCGT
GTCTAAGCTTGGTATGCAAGGTTTCTACCTCTGGATTTCTCGCGTTATTTAATTCTGCTTCACAGGAAAACTAGG
AACACAAGTGATTGTTCCCTACCGTGATGAAGATGATTCAAGAATTTTCAAGCCTATGGGTGATTTGGGTCAGAT
CGTTCGAATGGTAGCGTTCCAAATCCCTCGGCGTTTGGCTTGTGGTTCACGTTTTTGCTCCACGGTTCCGATAGG
AGTGGGATATTCGCAGTGAGCAACAGATTGCAGAATGCGTTCGACATTCGGATATCGTCTTTAACCTCGTTGGCC
GCGATTACGAGACAAAGTGAGTACTCTTGTCAAACAACATATGTAGCTCCTCTTATTGGCTTGAAATCGTTTTCA
ATATGTCGATTTGTCGATTTAGGAACTTTAAATTTGGAGATGTCCATATAGAAGGTGCCGAGCGCATCGCGAAGG
TTTGCGCAGCAGAGGGTGTCCCACGTTTCGTTCAAGTCTCGCACTTGAATGCTTCTGCAACATCTCAATCGAAAT
TCTATCAGACTAAAGCAGAAGGTGAGGAGCGGGTAAAAGCCGCTTTCCCAACTGCGACTGTCATGCGACCCGGCC
CCATGTACGGCTATGAGGATAGATTACTAAATAATATGGCATGTGAGTCTTCATTCAGCTACCCACCGGTACCGG
TGCTTACAGAATATATTGTAGTTTGGTCTATCTGGTGGAAGCTCAACCAAGCGGAGACTAGAATACGCCCAGTCC
ATGTAAGCTAACAATGGAACTAGCCATTGTTGTTCGTGACTTCTTGACGCTGTTATTTTATGTTGCAGGTCTTCG
ACGTCGCTCAAGCTCTTGCCAATCAAGTGGCGAATAACGTCTCTGGGCGCACGTTATCGCTACCGGGACCATCTA
CTCTCACGTACGAATACCTCCTCGACCTCATTTCTTCGGTGACTCTTCGGCCTCCTTCTCGGGCCCCCATGTTAC
CGAAGCCCATTGCACTGGCTGCAGCCAAATTAGCACAGAGTGTGTGGTGGCCTGCCCTCAGTCCCGATGAGGTTA
TTAGGCGTTATATCGACGATAGTGACGTTCCCGGTGACTGGGAAGTTGTCGGCGTAAATCCCACCGAAATTGAAT
CCCACGCCATCAAGTATTTGAGGCGCTACCGTACCGCGTATGTTCTGAAATGTGGTATCGAGATTGGGTACTCAT
GATTGCATCATTGTAGAGAAAATTATGTTCGCCCTGCGGTGATTCCGCCGAGACCGTCCGCCAAAGCCATTGTAA
GCACAAATGTCTTTTTATCAACGTTACCTCTCTGATAGATAATTTGCTTCGTTGTTCAAAGGTAGAGGAATATTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail