Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|102420
Gene name
Locationscaffold_07:1237479..1238133
Strand+
Gene length (bp)654
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00011 HSP20 Hsp20/alpha crystallin family 2.2E-04 62 150
PF00011 HSP20 Hsp20/alpha crystallin family 1.3E-08 153 198
PF17886 ArsA_HSP20 HSP20-like domain found in ArsA 1.5E-10 66 185

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P19752|HSP30_NEUCR 30 kDa heat shock protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp30 PE=3 SV=1 11 191 2.0E-10
sp|O14368|HSP16_SCHPO Heat shock protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp16 PE=1 SV=1 57 199 5.0E-09
sp|Q8MPA7|HSPG5_DICDI Small heat shock protein hspG5 OS=Dictyostelium discoideum GN=hspG5 PE=2 SV=2 58 195 9.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|102420
MSIARQLFREFRPFFRMLDEPFYRRAPPGLLPSDAMHRLDRENLLADPFTGLNMMTSPAVDVTEQGDKYVLDADL
PGVERENLQVRLGDGNQSITIEGKVTEKLSSGASEAGAQASGKSNNASEAEYTDASKSTSATKDNGATQISAERP
YTRNMSFTRTVWLPRSVDPNNVTAKLQNGVLSVTLNKAAEQTGRVVEIK*
Coding >Agabi119p4|102420
ATGTCTATTGCACGCCAGCTGTTTCGCGAATTCCGTCCCTTCTTTCGCATGTTAGACGAGCCTTTCTACAGGCGC
GCTCCTCCCGGTCTACTTCCCTCCGACGCTATGCATCGGCTTGACCGCGAAAATCTGCTTGCAGACCCATTCACG
GGTCTGAACATGATGACTTCTCCAGCGGTCGATGTGACGGAGCAGGGTGACAAATACGTCCTAGATGCCGACCTT
CCCGGGGTCGAGAGAGAGAATCTCCAAGTTCGTCTTGGAGACGGAAATCAGAGTATCACAATCGAGGGAAAGGTC
ACAGAAAAACTGTCTTCTGGAGCTTCGGAGGCAGGGGCTCAAGCAAGCGGCAAATCCAACAATGCCTCGGAAGCT
GAGTATACTGATGCATCCAAATCGACCTCTGCGACAAAAGACAACGGTGCGACGCAGATTTCGGCGGAGCGTCCG
TACACGAGGAATATGTCGTTTACACGGACTGTATGGCTACCGCGTTCGGTGGATCCGAATAATGTGACGGCAAAA
TTGCAGAATGGAGTGTTGAGCGTTACGCTGAACAAGGCCGCAGAGCAGACAGGACGGGTGGTCGAGATTAAGTAG
Transcript >Agabi119p4|102420
ATGTCTATTGCACGCCAGCTGTTTCGCGAATTCCGTCCCTTCTTTCGCATGTTAGACGAGCCTTTCTACAGGCGC
GCTCCTCCCGGTCTACTTCCCTCCGACGCTATGCATCGGCTTGACCGCGAAAATCTGCTTGCAGACCCATTCACG
GGTCTGAACATGATGACTTCTCCAGCGGTCGATGTGACGGAGCAGGGTGACAAATACGTCCTAGATGCCGACCTT
CCCGGGGTCGAGAGAGAGAATCTCCAAGTTCGTCTTGGAGACGGAAATCAGAGTATCACAATCGAGGGAAAGGTC
ACAGAAAAACTGTCTTCTGGAGCTTCGGAGGCAGGGGCTCAAGCAAGCGGCAAATCCAACAATGCCTCGGAAGCT
GAGTATACTGATGCATCCAAATCGACCTCTGCGACAAAAGACAACGGTGCGACGCAGATTTCGGCGGAGCGTCCG
TACACGAGGAATATGTCGTTTACACGGACTGTATGGCTACCGCGTTCGGTGGATCCGAATAATGTGACGGCAAAA
TTGCAGAATGGAGTGTTGAGCGTTACGCTGAACAAGGCCGCAGAGCAGACAGGACGGGTGGTCGAGATTAAGTAG
Gene >Agabi119p4|102420
ATGTCTATTGCACGCCAGCTGTTTCGCGAATTCCGTCCCTTCTTTCGCATGTTAGACGAGCCTTTCTACAGGCGC
GCTCCTCCCGGTCTACTTCCCTCCGACGCTATGCATCGGCTTGACCGCGAAAATCTGCTTGCAGACCCATTCACG
GGTCTGAACATGATGACTTCTCCAGCGGTCGATGTGACGGAGCAGGGTGACAAATACGTCCTAGATGCCGACCTT
CCCGGGGTCGAGAGAGAGAATCTCCAAGTTCGTCTTGGAGACGGAAATCAGAGTATCACAATCGAGGGAAAGGTC
ACAGAAAAACTGTCTTCTGGAGCTTCGGAGGCAGGGGCTCAAGCAAGCGGCAAATCCAACAATGCCTCGGAAGCT
GAGTATACTGATGGTACGTATATCAGATTGAGTCTACCAATGTTGGAAGTTCATGACGAGATGCCAGCATCCAAA
TCGACCTCTGCGACAAAAGACAACGGTGCGACGCAGATTTCGGCGGAGCGTCCGTACACGAGGAATATGTCGTTT
ACACGGACTGTATGGCTACCGCGTTCGGTGGATCCGAATAATGTGACGGCAAAATTGCAGAATGGAGTGTTGAGC
GTTACGCTGAACAAGGCCGCAGAGCAGACAGGACGGGTGGTCGAGATTAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail