Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|102330
Gene name
Locationscaffold_07:1213305..1214057
Strand+
Gene length (bp)752
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase 2.9E-22 44 129
PF10590 PNP_phzG_C Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region 6.5E-19 187 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2IX27|PDXH_NOSP7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pdxH PE=3 SV=1 22 233 5.0E-68
sp|A9AGI1|PDXH_BURM1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=pdxH PE=3 SV=1 26 233 9.0E-68
sp|Q0BCF1|PDXH_BURCM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pdxH PE=3 SV=1 26 233 1.0E-67
sp|B1YVG1|PDXH_BURA4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia ambifaria (strain MC40-6) GN=pdxH PE=3 SV=1 26 233 1.0E-67
sp|A4JHA1|PDXH_BURVG Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pdxH PE=3 SV=1 26 233 3.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2IX27|PDXH_NOSP7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pdxH PE=3 SV=1 22 233 5.0E-68
sp|A9AGI1|PDXH_BURM1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=pdxH PE=3 SV=1 26 233 9.0E-68
sp|Q0BCF1|PDXH_BURCM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pdxH PE=3 SV=1 26 233 1.0E-67
sp|B1YVG1|PDXH_BURA4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia ambifaria (strain MC40-6) GN=pdxH PE=3 SV=1 26 233 1.0E-67
sp|A4JHA1|PDXH_BURVG Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pdxH PE=3 SV=1 26 233 3.0E-67
sp|B4E9I1|PDXH_BURCJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=pdxH PE=3 SV=1 26 233 9.0E-67
sp|B1JXH8|PDXH_BURCC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia cenocepacia (strain MC0-3) GN=pdxH PE=3 SV=1 26 233 9.0E-67
sp|Q8YXG5|PDXH_NOSS1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pdxH PE=3 SV=1 22 233 9.0E-67
sp|A1V1A2|PDXH_BURMS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia mallei (strain SAVP1) GN=pdxH PE=3 SV=1 26 233 2.0E-66
sp|Q62M91|PDXH_BURMA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia mallei (strain ATCC 23344) GN=pdxH PE=3 SV=1 26 233 2.0E-66
sp|A2S933|PDXH_BURM9 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia mallei (strain NCTC 10229) GN=pdxH PE=3 SV=1 26 233 2.0E-66
sp|A3MHF0|PDXH_BURM7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia mallei (strain NCTC 10247) GN=pdxH PE=3 SV=1 26 233 2.0E-66
sp|Q63WN7|PDXH_BURPS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia pseudomallei (strain K96243) GN=pdxH PE=3 SV=2 26 233 2.0E-66
sp|A3N6I1|PDXH_BURP6 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia pseudomallei (strain 668) GN=pdxH PE=3 SV=1 26 233 2.0E-66
sp|Q3JVD0|PDXH_BURP1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia pseudomallei (strain 1710b) GN=pdxH PE=3 SV=2 26 233 2.0E-66
sp|A3NS64|PDXH_BURP0 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia pseudomallei (strain 1106a) GN=pdxH PE=3 SV=1 26 233 2.0E-66
sp|Q3MFQ5|PDXH_ANAVT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pdxH PE=3 SV=1 22 233 2.0E-66
sp|Q2T0M6|PDXH_BURTA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pdxH PE=3 SV=2 26 233 6.0E-66
sp|Q39DH2|PDXH_BURL3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pdxH PE=3 SV=1 26 233 1.0E-65
sp|Q8Y1C3|PDXH1_RALSO Pyridoxine/pyridoxamine 5'-phosphate oxidase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=pdxH1 PE=3 SV=1 29 233 1.0E-65
sp|A0K9Z1|PDXH_BURCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia cenocepacia (strain HI2424) GN=pdxH PE=3 SV=1 26 233 1.0E-65
sp|Q1BU45|PDXH_BURCA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia cenocepacia (strain AU 1054) GN=pdxH PE=3 SV=1 26 233 1.0E-65
sp|B8HMK7|PDXH_CYAP4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=pdxH PE=3 SV=1 26 233 3.0E-65
sp|B7K9I2|PDXH_CYAP7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cyanothece sp. (strain PCC 7424) GN=pdxH PE=3 SV=1 22 233 4.0E-65
sp|A9I847|PDXH_BORPD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pdxH PE=3 SV=1 30 233 1.0E-64
sp|Q13UP6|PDXH_BURXL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia xenovorans (strain LB400) GN=pdxH PE=3 SV=1 31 233 1.0E-64
sp|B2SY78|PDXH_BURPP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=pdxH PE=3 SV=1 29 233 4.0E-64
sp|A1TWZ3|PDXH_MARHV Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pdxH PE=3 SV=1 31 233 4.0E-64
sp|B2U826|PDXH_RALPJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ralstonia pickettii (strain 12J) GN=pdxH PE=3 SV=1 29 233 5.0E-64
sp|Q2KVR0|PDXH_BORA1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella avium (strain 197N) GN=pdxH PE=3 SV=1 34 233 1.0E-63
sp|Q7VU72|PDXH_BORPE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pdxH PE=3 SV=1 34 233 3.0E-63
sp|Q7W4Q1|PDXH_BORPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pdxH PE=3 SV=1 34 233 3.0E-63
sp|Q7WG77|PDXH_BORBR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pdxH PE=3 SV=1 34 233 3.0E-63
sp|A1SUY2|PDXH_PSYIN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Psychromonas ingrahamii (strain 37) GN=pdxH PE=3 SV=1 35 233 4.0E-63
sp|B3R5Q8|PDXH_CUPTR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=pdxH PE=3 SV=1 26 233 7.0E-63
sp|B2JDT0|PDXH_BURP8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pdxH PE=3 SV=1 29 233 1.0E-62
sp|B7JZR4|PDXH_CYAP8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cyanothece sp. (strain PCC 8801) GN=pdxH PE=3 SV=1 22 233 1.0E-62
sp|Q474I9|PDXH_CUPPJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pdxH PE=3 SV=1 26 233 3.0E-62
sp|Q1ATH8|PDXH_RUBXD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pdxH PE=3 SV=2 10 233 4.0E-62
sp|Q2S544|PDXH_SALRD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pdxH PE=3 SV=1 26 233 2.0E-61
sp|P74211|PDXH_SYNY3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pdxH PE=3 SV=2 22 233 2.0E-61
sp|B1WR90|PDXH_CYAA5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cyanothece sp. (strain ATCC 51142) GN=pdxH PE=3 SV=1 22 233 4.0E-61
sp|Q0K7Z0|PDXH_CUPNH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pdxH PE=3 SV=1 26 233 7.0E-61
sp|Q8DLZ5|PDXH_THEEB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Thermosynechococcus elongatus (strain BP-1) GN=pdxH PE=3 SV=1 29 233 2.0E-60
sp|B0C079|PDXH_ACAM1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acaryochloris marina (strain MBIC 11017) GN=pdxH PE=3 SV=1 29 233 3.0E-60
sp|B0JI39|PDXH_MICAN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Microcystis aeruginosa (strain NIES-843) GN=pdxH PE=3 SV=1 24 233 3.0E-60
sp|Q1LK07|PDXH_CUPMC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pdxH PE=3 SV=1 26 233 9.0E-60
sp|B0BU37|PDXH_ACTPJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pdxH PE=3 SV=1 26 233 5.0E-59
sp|A3N3U7|PDXH_ACTP2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pdxH PE=3 SV=1 26 233 9.0E-59
sp|B3GZF5|PDXH_ACTP7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pdxH PE=3 SV=1 26 233 7.0E-58
sp|Q487G8|PDXH_COLP3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pdxH PE=3 SV=1 32 213 8.0E-58
sp|Q47TD1|PDXH_THEFY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Thermobifida fusca (strain YX) GN=pdxH PE=3 SV=1 26 233 2.0E-57
sp|Q1IDT9|PDXH_PSEE4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas entomophila (strain L48) GN=pdxH PE=3 SV=1 22 233 2.0E-57
sp|Q65QT9|PDXH_MANSM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pdxH PE=3 SV=1 22 233 2.0E-57
sp|A8M0C0|PDXH_SALAI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salinispora arenicola (strain CNS-205) GN=pdxH PE=3 SV=1 19 233 5.0E-57
sp|A6T1X9|PDXH_JANMA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Janthinobacterium sp. (strain Marseille) GN=pdxH PE=3 SV=1 22 233 5.0E-57
sp|A4SWL7|PDXH_POLSQ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=pdxH PE=3 SV=1 22 233 5.0E-57
sp|A2CDU4|PDXH_PROM3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Prochlorococcus marinus (strain MIT 9303) GN=pdxH PE=3 SV=1 31 233 9.0E-57
sp|Q9K3V7|PDXH_STRCO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pdxH PE=3 SV=1 26 233 2.0E-56
sp|B7UXE2|PDXH_PSEA8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain LESB58) GN=pdxH PE=3 SV=1 22 233 2.0E-56
sp|Q7V3Y6|PDXH_PROMM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Prochlorococcus marinus (strain MIT 9313) GN=pdxH PE=3 SV=1 35 233 3.0E-56
sp|Q02IL5|PDXH_PSEAB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pdxH PE=3 SV=1 22 233 3.0E-56
sp|C5BN92|PDXH_TERTT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pdxH PE=3 SV=1 33 233 5.0E-56
sp|Q9I4S5|PDXH_PSEAE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pdxH PE=3 SV=1 22 233 6.0E-56
sp|B1J1C4|PDXH_PSEPW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas putida (strain W619) GN=pdxH PE=3 SV=1 22 233 7.0E-56
sp|A6V9E9|PDXH_PSEA7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain PA7) GN=pdxH PE=3 SV=1 22 233 2.0E-55
sp|Q3KGY4|PDXH_PSEPF Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pdxH PE=3 SV=1 22 233 3.0E-55
sp|A8EV17|PDXH_ARCB4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Arcobacter butzleri (strain RM4018) GN=pdxH PE=3 SV=1 31 233 4.0E-55
sp|Q4QM38|PDXH_HAEI8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Haemophilus influenzae (strain 86-028NP) GN=pdxH PE=3 SV=2 26 233 4.0E-55
sp|A1AW86|PDXH_RUTMC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=pdxH PE=3 SV=1 15 233 5.0E-55
sp|P44909|PDXH_HAEIN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pdxH PE=3 SV=2 26 233 5.0E-55
sp|A5EXX0|PDXH_DICNV Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Dichelobacter nodosus (strain VCS1703A) GN=pdxH PE=3 SV=1 20 233 5.0E-55
sp|Q2JGW9|PDXH_FRASC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Frankia sp. (strain CcI3) GN=pdxH PE=3 SV=2 25 216 9.0E-55
sp|B0KUA9|PDXH_PSEPG Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas putida (strain GB-1) GN=pdxH PE=3 SV=1 22 233 1.0E-54
sp|B4RVA4|PDXH_ALTMD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pdxH PE=3 SV=1 26 233 2.0E-54
sp|A4VJR0|PDXH_PSEU5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas stutzeri (strain A1501) GN=pdxH PE=3 SV=1 22 233 3.0E-54
sp|A5VZL6|PDXH_PSEP1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pdxH PE=3 SV=1 22 233 3.0E-54
sp|Q31E41|PDXH2_THICR Pyridoxine/pyridoxamine 5'-phosphate oxidase 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=pdxH2 PE=3 SV=1 24 233 3.0E-54
sp|A4G883|PDXH_HERAR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Herminiimonas arsenicoxydans GN=pdxH PE=3 SV=1 26 233 3.0E-54
sp|Q48LQ7|PDXH_PSE14 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pdxH PE=3 SV=1 22 233 3.0E-54
sp|C3K863|PDXH_PSEFS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas fluorescens (strain SBW25) GN=pdxH PE=3 SV=1 22 233 4.0E-54
sp|Q88NS5|PDXH_PSEPK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas putida (strain KT2440) GN=pdxH PE=3 SV=1 22 233 5.0E-54
sp|Q1QWA6|PDXH_CHRSD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pdxH PE=3 SV=1 26 233 8.0E-54
sp|A6VKX9|PDXH_ACTSZ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pdxH PE=3 SV=1 22 233 1.0E-53
sp|A2SJZ5|PDXH_METPP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Methylibium petroleiphilum (strain PM1) GN=pdxH PE=3 SV=2 35 233 3.0E-53
sp|Q9LTX3|PPOX1_ARATH Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic OS=Arabidopsis thaliana GN=PPOX1 PE=1 SV=1 31 233 3.0E-53
sp|Q87XR0|PDXH_PSESM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pdxH PE=3 SV=1 22 233 3.0E-53
sp|Q0RUF3|PDXH_FRAAA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Frankia alni (strain ACN14a) GN=pdxH PE=3 SV=1 26 233 3.0E-53
sp|Q54YS6|PNPO_DICDI Pyridoxine-5'-phosphate oxidase OS=Dictyostelium discoideum GN=pnpo PE=3 SV=1 34 233 3.0E-53
sp|A8GDX9|PDXH_SERP5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Serratia proteamaculans (strain 568) GN=pdxH PE=3 SV=1 22 233 4.0E-53
sp|Q2SDP4|PDXH_HAHCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Hahella chejuensis (strain KCTC 2396) GN=pdxH PE=3 SV=1 26 233 4.0E-53
sp|Q9UTQ1|PDX3_SCHPO Probable pyridoxamine 5'-phosphate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.02 PE=3 SV=1 19 215 4.0E-53
sp|Q7VP83|PDXH_HAEDU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pdxH PE=3 SV=1 22 233 4.0E-53
sp|C1D0Z0|PDXH_DEIDV Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=pdxH PE=3 SV=1 22 233 5.0E-53
sp|Q9JYZ5|PDXH_NEIMB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pdxH PE=3 SV=1 26 233 6.0E-53
sp|A1KUI2|PDXH_NEIMF Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=pdxH PE=3 SV=1 26 233 6.0E-53
sp|Q9JTZ1|PDXH_NEIMA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pdxH PE=3 SV=1 26 233 6.0E-53
sp|Q7UKQ9|PDXH_RHOBA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pdxH PE=3 SV=1 35 233 7.0E-53
sp|P38075|PDX3_YEAST Pyridoxamine 5'-phosphate oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDX3 PE=1 SV=1 26 233 1.0E-52
sp|A9M007|PDXH_NEIM0 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pdxH PE=3 SV=1 26 233 1.0E-52
sp|Q21IG1|PDXH_SACD2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pdxH PE=3 SV=1 34 233 2.0E-52
sp|Q21WR9|PDXH_RHOFT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=pdxH PE=3 SV=2 26 233 2.0E-52
sp|B7LQN2|PDXH_ESCF3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pdxH PE=3 SV=1 7 233 2.0E-52
sp|B4RM90|PDXH_NEIG2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pdxH PE=3 SV=1 26 233 2.0E-52
sp|Q5F8V2|PDXH_NEIG1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pdxH PE=3 SV=1 26 233 2.0E-52
sp|Q4ZPN9|PDXH_PSEU2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pdxH PE=3 SV=1 22 233 3.0E-52
sp|P0AFI8|PDXH_SHIFL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella flexneri GN=pdxH PE=3 SV=2 7 233 4.0E-52
sp|Q0T4D9|PDXH_SHIF8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella flexneri serotype 5b (strain 8401) GN=pdxH PE=3 SV=1 7 233 4.0E-52
sp|Q32FD5|PDXH_SHIDS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pdxH PE=3 SV=1 7 233 4.0E-52
sp|Q320Z5|PDXH_SHIBS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella boydii serotype 4 (strain Sb227) GN=pdxH PE=3 SV=1 7 233 4.0E-52
sp|B7NB92|PDXH_ECOLU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pdxH PE=3 SV=1 7 233 4.0E-52
sp|P0AFI7|PDXH_ECOLI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain K12) GN=pdxH PE=1 SV=2 7 233 4.0E-52
sp|B1IQB6|PDXH_ECOLC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pdxH PE=3 SV=1 7 233 4.0E-52
sp|A8A0I1|PDXH_ECOHS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O9:H4 (strain HS) GN=pdxH PE=3 SV=1 7 233 4.0E-52
sp|B1XFV0|PDXH_ECODH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain K12 / DH10B) GN=pdxH PE=3 SV=1 7 233 4.0E-52
sp|C4ZYA1|PDXH_ECOBW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pdxH PE=3 SV=1 7 233 4.0E-52
sp|B7URX9|PDXH_ECO27 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pdxH PE=3 SV=1 7 233 4.0E-52
sp|Q4KH71|PDXH_PSEF5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pdxH PE=3 SV=1 22 233 4.0E-52
sp|B2VEN4|PDXH_ERWT9 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pdxH PE=3 SV=1 11 233 4.0E-52
sp|A7FHL9|PDXH_YERP3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pdxH PE=3 SV=1 29 233 5.0E-52
sp|Q66A48|PDXH_YERPS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pdxH PE=3 SV=1 29 233 6.0E-52
sp|Q1CIM4|PDXH_YERPN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pdxH PE=3 SV=2 29 233 6.0E-52
sp|A9QZ96|PDXH_YERPG Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pdxH PE=3 SV=1 29 233 6.0E-52
sp|Q8ZE19|PDXH_YERPE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pestis GN=pdxH PE=3 SV=1 29 233 6.0E-52
sp|Q1C790|PDXH_YERPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pdxH PE=3 SV=2 29 233 6.0E-52
sp|A1URW0|PDXH_BARBK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pdxH PE=3 SV=1 30 233 7.0E-52
sp|B1XYE2|PDXH_LEPCP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pdxH PE=3 SV=1 34 233 8.0E-52
sp|Q6D5V3|PDXH_PECAS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pdxH PE=3 SV=1 34 233 9.0E-52
sp|B1LEP8|PDXH_ECOSM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pdxH PE=3 SV=1 7 233 1.0E-51
sp|B7NTZ4|PDXH_ECO7I Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pdxH PE=3 SV=1 7 233 1.0E-51
sp|A1W7K9|PDXH_ACISJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acidovorax sp. (strain JS42) GN=pdxH PE=3 SV=1 26 233 1.0E-51
sp|B5Z472|PDXH_ECO5E Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pdxH PE=3 SV=1 7 233 1.0E-51
sp|Q8X647|PDXH_ECO57 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O157:H7 GN=pdxH PE=3 SV=1 7 233 1.0E-51
sp|Q8Z6Q2|PDXH_SALTI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella typhi GN=pdxH PE=3 SV=1 7 233 1.0E-51
sp|A6T9Y6|PDXH_KLEP7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pdxH PE=3 SV=2 7 233 1.0E-51
sp|Q9RX20|PDXH_DEIRA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pdxH PE=3 SV=1 31 233 2.0E-51
sp|Q8ZPM9|PDXH_SALTY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|B4TV07|PDXH_SALSV Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella schwarzengrund (strain CVM19633) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|B5BKC1|PDXH_SALPK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella paratyphi A (strain AKU_12601) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|C0Q5T4|PDXH_SALPC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella paratyphi C (strain RKS4594) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|A9N035|PDXH_SALPB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|Q5PIK6|PDXH_SALPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|B4T585|PDXH_SALNS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella newport (strain SL254) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|B4THC5|PDXH_SALHS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella heidelberg (strain SL476) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|B5RAL1|PDXH_SALG2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|B5QV11|PDXH_SALEP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella enteritidis PT4 (strain P125109) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|B5FIF5|PDXH_SALDC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella dublin (strain CT_02021853) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|Q57PI9|PDXH_SALCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella choleraesuis (strain SC-B67) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|B5F6J9|PDXH_SALA4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella agona (strain SL483) GN=pdxH PE=3 SV=1 7 233 2.0E-51
sp|A4XS85|PDXH_PSEMY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas mendocina (strain ymp) GN=pdxH PE=3 SV=1 22 233 2.0E-51
sp|Q8G2A9|PDXH_BRUSU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella suis biovar 1 (strain 1330) GN=pdxH PE=3 SV=1 30 233 2.0E-51
sp|Q8YFK3|PDXH_BRUME Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdxH PE=3 SV=1 30 233 2.0E-51
sp|Q57EU9|PDXH_BRUAB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella abortus biovar 1 (strain 9-941) GN=pdxH PE=3 SV=1 30 233 2.0E-51
sp|Q2YMD1|PDXH_BRUA2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella abortus (strain 2308) GN=pdxH PE=3 SV=1 30 233 2.0E-51
sp|B0CKA2|PDXH_BRUSI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdxH PE=3 SV=1 30 233 3.0E-51
sp|C0RHC3|PDXH_BRUMB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pdxH PE=3 SV=1 30 233 3.0E-51
sp|A9M8J1|PDXH_BRUC2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdxH PE=3 SV=1 30 233 3.0E-51
sp|B2S9Q7|PDXH_BRUA1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella abortus (strain S19) GN=pdxH PE=3 SV=1 30 233 3.0E-51
sp|Q3Z1Z4|PDXH_SHISS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella sonnei (strain Ss046) GN=pdxH PE=3 SV=1 7 233 3.0E-51
sp|B2U2D8|PDXH_SHIB3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pdxH PE=3 SV=1 7 233 3.0E-51
sp|B6IB77|PDXH_ECOSE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain SE11) GN=pdxH PE=3 SV=1 7 233 3.0E-51
sp|B7M0J5|PDXH_ECO8A Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O8 (strain IAI1) GN=pdxH PE=3 SV=1 7 233 3.0E-51
sp|B7L5J1|PDXH_ECO55 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain 55989 / EAEC) GN=pdxH PE=3 SV=1 7 233 3.0E-51
sp|Q1RBF7|PDXH_ECOUT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain UTI89 / UPEC) GN=pdxH PE=3 SV=1 7 233 4.0E-51
sp|Q8FH87|PDXH_ECOL6 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pdxH PE=3 SV=1 7 233 4.0E-51
sp|Q0THJ0|PDXH_ECOL5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pdxH PE=3 SV=1 7 233 4.0E-51
sp|A1ABI3|PDXH_ECOK1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O1:K1 / APEC GN=pdxH PE=3 SV=1 7 233 4.0E-51
sp|B7MVB6|PDXH_ECO81 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O81 (strain ED1a) GN=pdxH PE=3 SV=1 7 233 4.0E-51
sp|B7M9Z2|PDXH_ECO45 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pdxH PE=3 SV=1 7 233 4.0E-51
sp|Q83D18|PDXH_COXBU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pdxH PE=3 SV=1 35 233 4.0E-51
sp|Q87FE9|PDXH_VIBPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pdxH PE=3 SV=1 31 233 5.0E-51
sp|A7ZMA0|PDXH_ECO24 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pdxH PE=3 SV=1 7 233 5.0E-51
sp|Q11U72|PDXH_CYTH3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pdxH PE=3 SV=1 33 233 5.0E-51
sp|Q8F6Y3|PDXH_LEPIN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=pdxH PE=3 SV=1 35 233 6.0E-51
sp|Q72PF1|PDXH_LEPIC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=pdxH PE=3 SV=1 35 233 6.0E-51
sp|A6WE21|PDXH_KINRD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=pdxH PE=3 SV=1 19 233 6.0E-51
sp|A1JNV9|PDXH_YERE8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pdxH PE=3 SV=1 29 233 6.0E-51
sp|A7MMK2|PDXH_CROS8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pdxH PE=3 SV=1 12 233 8.0E-51
sp|A0LR32|PDXH_ACIC1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=pdxH PE=3 SV=1 22 233 8.0E-51
sp|Q1DCS1|PDXH_MYXXD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Myxococcus xanthus (strain DK 1622) GN=pdxH PE=3 SV=2 31 233 1.0E-50
sp|Q126S5|PDXH_POLSJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pdxH PE=3 SV=2 35 233 1.0E-50
sp|A5VNZ1|PDXH_BRUO2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdxH PE=3 SV=1 30 233 1.0E-50
sp|P21159|PDXH_MYXXA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Myxococcus xanthus GN=pdxH PE=1 SV=2 31 233 1.0E-50
sp|A4W9V9|PDXH_ENT38 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Enterobacter sp. (strain 638) GN=pdxH PE=3 SV=1 7 233 2.0E-50
sp|A1VRL0|PDXH_POLNA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Polaromonas naphthalenivorans (strain CJ2) GN=pdxH PE=3 SV=1 35 233 2.0E-50
sp|Q7P203|PDXH_CHRVO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pdxH PE=3 SV=1 17 233 3.0E-50
sp|A8AH19|PDXH_CITK8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pdxH PE=3 SV=1 7 233 3.0E-50
sp|Q6G0E0|PDXH_BARQU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bartonella quintana (strain Toulouse) GN=pdxH PE=3 SV=1 35 233 6.0E-50
sp|A4F7G2|PDXH_SACEN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pdxH PE=3 SV=1 37 233 6.0E-50
sp|Q1J188|PDXH_DEIGD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Deinococcus geothermalis (strain DSM 11300) GN=pdxH PE=3 SV=1 22 233 7.0E-50
sp|A1WL02|PDXH_VEREI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Verminephrobacter eiseniae (strain EF01-2) GN=pdxH PE=3 SV=1 26 233 7.0E-50
sp|A7N7P0|PDXH_VIBCB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pdxH PE=3 SV=1 31 233 8.0E-50
sp|Q4FN05|PDXH_PELUB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pelagibacter ubique (strain HTCC1062) GN=pdxH PE=3 SV=1 35 233 1.0E-49
sp|Q0VSU8|PDXH_ALCBS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pdxH PE=3 SV=1 24 233 1.0E-49
sp|Q5FPH2|PDXH_GLUOX Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Gluconobacter oxydans (strain 621H) GN=pdxH PE=3 SV=1 35 233 1.0E-49
sp|A1TQY3|PDXH_ACIAC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acidovorax citrulli (strain AAC00-1) GN=pdxH PE=3 SV=1 35 233 2.0E-49
sp|Q7MBT9|PDXH_VIBVY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio vulnificus (strain YJ016) GN=pdxH PE=3 SV=2 35 233 2.0E-49
sp|Q8D510|PDXH_VIBVU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio vulnificus (strain CMCP6) GN=pdxH PE=3 SV=1 35 233 2.0E-49
sp|Q04ZE7|PDXH_LEPBL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=pdxH PE=3 SV=1 31 233 2.0E-49
sp|Q04R37|PDXH_LEPBJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=pdxH PE=3 SV=1 31 233 2.0E-49
sp|A5FB76|PDXH_FLAJ1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pdxH PE=3 SV=1 35 232 3.0E-49
sp|Q15R35|PDXH_PSEA6 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pdxH PE=3 SV=1 22 233 3.0E-49
sp|Q89RY8|PDXH_BRADU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pdxH PE=3 SV=1 30 233 4.0E-49
sp|A6WWA8|PDXH_OCHA4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdxH PE=3 SV=2 30 233 4.0E-49
sp|Q083L3|PDXH_SHEFN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pdxH PE=3 SV=1 22 233 4.0E-49
sp|A4SKR0|PDXH_AERS4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Aeromonas salmonicida (strain A449) GN=pdxH PE=3 SV=2 35 233 4.0E-49
sp|Q73G09|PDXH_WOLPM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Wolbachia pipientis wMel GN=pdxH PE=3 SV=1 30 233 4.0E-49
sp|A5CX08|PDXH_VESOH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=pdxH PE=3 SV=1 22 233 6.0E-49
sp|B4EWL7|PDXH_PROMH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Proteus mirabilis (strain HI4320) GN=pdxH PE=3 SV=1 31 233 7.0E-49
sp|Q6LFS0|PDXH_PHOPR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Photobacterium profundum GN=pdxH PE=3 SV=1 35 233 7.0E-49
sp|Q5WZ02|PDXH_LEGPL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Legionella pneumophila (strain Lens) GN=pdxH PE=3 SV=1 25 233 8.0E-49
sp|Q5ZY37|PDXH_LEGPH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pdxH PE=3 SV=1 25 233 2.0E-48
sp|A5IH19|PDXH_LEGPC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Legionella pneumophila (strain Corby) GN=pdxH PE=3 SV=1 25 233 2.0E-48
sp|Q5X7K4|PDXH_LEGPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Legionella pneumophila (strain Paris) GN=pdxH PE=3 SV=1 25 233 2.0E-48
sp|Q82GN9|PDXH_STRAW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pdxH PE=3 SV=1 35 233 2.0E-48
sp|C3LWZ1|PDXH_VIBCM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pdxH PE=3 SV=1 23 233 3.0E-48
sp|Q9KKM4|PDXH_VIBCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pdxH PE=3 SV=1 23 233 3.0E-48
sp|A5F176|PDXH_VIBC3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pdxH PE=3 SV=1 23 233 4.0E-48
sp|Q13BJ4|PDXH_RHOPS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain BisB5) GN=pdxH PE=3 SV=1 30 215 5.0E-48
sp|B6EQ13|PDXH_ALISL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Aliivibrio salmonicida (strain LFI1238) GN=pdxH PE=3 SV=1 34 233 5.0E-48
sp|Q9A9Q6|PDXH_CAUCR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pdxH PE=3 SV=1 35 233 5.0E-48
sp|B8H292|PDXH_CAUCN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pdxH PE=3 SV=1 35 233 5.0E-48
sp|Q6G4D7|PDXH_BARHE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pdxH PE=3 SV=1 35 233 6.0E-48
sp|A5WEW5|PDXH_PSYWF Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Psychrobacter sp. (strain PRwf-1) GN=pdxH PE=3 SV=1 35 233 2.0E-47
sp|Q2J0U5|PDXH_RHOP2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain HaA2) GN=pdxH PE=3 SV=1 30 233 2.0E-47
sp|Q07HS0|PDXH_RHOP5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain BisA53) GN=pdxH PE=3 SV=1 30 217 2.0E-47
sp|Q1QC15|PDXH_PSYCK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Psychrobacter cryohalolentis (strain K5) GN=pdxH PE=3 SV=1 18 219 2.0E-47
sp|A3QDE1|PDXH_SHELP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pdxH PE=3 SV=1 34 233 2.0E-47
sp|B7VPY4|PDXH_VIBTL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio tasmaniensis (strain LGP32) GN=pdxH PE=3 SV=1 31 233 3.0E-47
sp|A8HRJ3|PDXH_AZOC5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pdxH PE=3 SV=2 30 233 3.0E-47
sp|A0KI46|PDXH_AERHH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pdxH PE=3 SV=2 35 233 4.0E-47
sp|A5FWR6|PDXH_ACICJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acidiphilium cryptum (strain JF-5) GN=pdxH PE=3 SV=1 31 233 4.0E-47
sp|C1DEH4|PDXH_AZOVD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pdxH PE=3 SV=1 35 233 4.0E-47
sp|C3MHI2|PDXH_RHISN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium sp. (strain NGR234) GN=pdxH PE=3 SV=1 35 233 5.0E-47
sp|O88794|PNPO_RAT Pyridoxine-5'-phosphate oxidase OS=Rattus norvegicus GN=Pnpo PE=1 SV=1 35 233 6.0E-47
sp|Q8A7E7|PDXH_BACTN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pdxH PE=3 SV=1 19 233 6.0E-47
sp|B5EVT2|PDXH_VIBFM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio fischeri (strain MJ11) GN=pdxH PE=3 SV=1 35 233 7.0E-47
sp|Q5DYB5|PDXH_VIBF1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pdxH PE=3 SV=1 35 233 7.0E-47
sp|Q6F718|PDXH_ACIAD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pdxH PE=3 SV=1 26 233 7.0E-47
sp|Q11KF1|PDXH_CHESB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Chelativorans sp. (strain BNC1) GN=pdxH PE=3 SV=1 35 233 1.0E-46
sp|C5BE32|PDXH_EDWI9 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Edwardsiella ictaluri (strain 93-146) GN=pdxH PE=3 SV=1 31 233 1.0E-46
sp|Q5E9K3|PNPO_BOVIN Pyridoxine-5'-phosphate oxidase OS=Bos taurus GN=PNPO PE=2 SV=1 35 233 1.0E-46
sp|A6U6T5|PDXH_SINMW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Sinorhizobium medicae (strain WSM419) GN=pdxH PE=3 SV=1 35 215 1.0E-46
sp|Q12LW9|PDXH_SHEDO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pdxH PE=3 SV=1 34 233 1.0E-46
sp|B9JSN3|PDXH_AGRVS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pdxH PE=3 SV=1 35 215 3.0E-46
sp|A4YQ21|PDXH_BRASO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bradyrhizobium sp. (strain ORS278) GN=pdxH PE=3 SV=1 35 215 6.0E-46
sp|Q6MK45|PDXH_BDEBA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pdxH PE=3 SV=1 31 233 1.0E-45
sp|Q92RH8|PDXH_RHIME Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium meliloti (strain 1021) GN=pdxH PE=3 SV=1 35 215 1.0E-45
sp|A8FWJ0|PDXH_SHESH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sediminis (strain HAW-EB3) GN=pdxH PE=3 SV=1 35 233 1.0E-45
sp|B0SPV0|PDXH_LEPBP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=pdxH PE=3 SV=1 26 233 1.0E-45
sp|B0SGE9|PDXH_LEPBA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=pdxH PE=3 SV=1 26 233 1.0E-45
sp|A0M2G0|PDXH_GRAFK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Gramella forsetii (strain KT0803) GN=pdxH PE=3 SV=1 35 233 1.0E-45
sp|A5EEN4|PDXH_BRASB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pdxH PE=3 SV=1 35 215 2.0E-45
sp|Q8UHC2|PDXH_AGRFC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pdxH PE=3 SV=1 21 215 2.0E-45
sp|Q91XF0|PNPO_MOUSE Pyridoxine-5'-phosphate oxidase OS=Mus musculus GN=Pnpo PE=1 SV=1 35 233 2.0E-45
sp|Q2W8Y5|PDXH_MAGSA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pdxH PE=3 SV=2 29 233 2.0E-45
sp|B3QIK5|PDXH_RHOPT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain TIE-1) GN=pdxH PE=3 SV=1 30 215 3.0E-45
sp|Q6NAI9|PDXH_RHOPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pdxH PE=3 SV=1 30 215 3.0E-45
sp|A9KY72|PDXH_SHEB9 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella baltica (strain OS195) GN=pdxH PE=3 SV=1 34 233 5.0E-45
sp|A6WM67|PDXH_SHEB8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella baltica (strain OS185) GN=pdxH PE=3 SV=1 34 233 5.0E-45
sp|A3D3G4|PDXH_SHEB5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pdxH PE=3 SV=1 34 233 5.0E-45
sp|B8EAI0|PDXH_SHEB2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella baltica (strain OS223) GN=pdxH PE=3 SV=1 34 233 5.0E-45
sp|Q31IR4|PDXH1_THICR Pyridoxine/pyridoxamine 5'-phosphate oxidase 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=pdxH1 PE=3 SV=1 29 233 6.0E-45
sp|Q1GHI5|PDXH_RUEST Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ruegeria sp. (strain TM1040) GN=pdxH PE=3 SV=1 35 233 6.0E-45
sp|Q0HW76|PDXH_SHESR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sp. (strain MR-7) GN=pdxH PE=3 SV=1 34 233 6.0E-45
sp|Q8ED71|PDXH_SHEON Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella oneidensis (strain MR-1) GN=pdxH PE=3 SV=1 34 233 8.0E-45
sp|Q7N3W5|PDXH_PHOLL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pdxH PE=3 SV=1 35 233 8.0E-45
sp|Q1GVE7|PDXH_SPHAL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pdxH PE=3 SV=1 35 216 9.0E-45
sp|Q3IDP4|PDXH_PSEHT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pdxH PE=3 SV=1 23 233 9.0E-45
sp|A6H098|PDXH_FLAPJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pdxH PE=3 SV=1 29 233 9.0E-45
sp|Q4FS02|PDXH_PSYA2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pdxH PE=3 SV=1 18 219 1.0E-44
sp|A0KVP0|PDXH_SHESA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sp. (strain ANA-3) GN=pdxH PE=3 SV=1 34 233 1.0E-44
sp|Q0HJY0|PDXH_SHESM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sp. (strain MR-4) GN=pdxH PE=3 SV=1 34 233 1.0E-44
sp|A7II77|PDXH_XANP2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pdxH PE=3 SV=1 35 233 2.0E-44
sp|Q1LU04|PDXH_BAUCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pdxH PE=3 SV=1 22 233 3.0E-44
sp|Q0ARD7|PDXH_MARMM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Maricaulis maris (strain MCS10) GN=pdxH PE=3 SV=1 35 233 4.0E-44
sp|B9JAN3|PDXH_AGRRK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pdxH PE=3 SV=1 30 215 4.0E-44
sp|Q21A86|PDXH_RHOPB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain BisB18) GN=pdxH PE=3 SV=1 30 215 4.0E-44
sp|Q986A0|PDXH_RHILO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium loti (strain MAFF303099) GN=pdxH PE=3 SV=1 21 233 4.0E-44
sp|Q1QQ51|PDXH_NITHX Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pdxH PE=3 SV=1 35 233 4.0E-44
sp|Q2GFR2|PDXH_EHRCR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=pdxH PE=3 SV=1 31 233 6.0E-44
sp|A1S710|PDXH_SHEAM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pdxH PE=3 SV=1 22 233 6.0E-44
sp|Q3J3Y3|PDXH_RHOS4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pdxH PE=3 SV=1 42 233 7.0E-44
sp|Q3YSS1|PDXH_EHRCJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ehrlichia canis (strain Jake) GN=pdxH PE=3 SV=1 35 233 7.0E-44
sp|Q2RR21|PDXH_RHORT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pdxH PE=3 SV=1 35 233 8.0E-44
sp|Q8XS03|PDXH2_RALSO Pyridoxine/pyridoxamine 5'-phosphate oxidase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=pdxH2 PE=3 SV=1 35 215 8.0E-44
sp|B0VNC8|PDXH_ACIBS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain SDF) GN=pdxH PE=3 SV=1 18 233 8.0E-44
sp|Q5HBZ2|PDXH_EHRRW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ehrlichia ruminantium (strain Welgevonden) GN=pdxH PE=3 SV=1 31 217 1.0E-43
sp|Q5FH81|PDXH_EHRRG Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ehrlichia ruminantium (strain Gardel) GN=pdxH PE=3 SV=1 31 217 1.0E-43
sp|Q3SV02|PDXH_NITWN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pdxH PE=3 SV=1 35 215 1.0E-43
sp|B1KRD7|PDXH_SHEWM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pdxH PE=3 SV=1 35 233 1.0E-43
sp|A1RKK6|PDXH_SHESW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sp. (strain W3-18-1) GN=pdxH PE=3 SV=1 34 233 1.0E-43
sp|Q2GCC6|PDXH_NOVAD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pdxH PE=3 SV=1 35 233 1.0E-43
sp|Q2NT03|PDXH_SODGM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Sodalis glossinidius (strain morsitans) GN=pdxH PE=3 SV=1 22 233 2.0E-43
sp|Q64WC2|PDXH_BACFR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bacteroides fragilis (strain YCH46) GN=pdxH PE=3 SV=1 34 233 4.0E-43
sp|Q5LFJ5|PDXH_BACFN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pdxH PE=3 SV=1 34 233 4.0E-43
sp|Q9NVS9|PNPO_HUMAN Pyridoxine-5'-phosphate oxidase OS=Homo sapiens GN=PNPO PE=1 SV=1 35 215 4.0E-43
sp|B0V9C9|PDXH_ACIBY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain AYE) GN=pdxH PE=3 SV=1 18 233 4.0E-43
sp|A3M9W4|PDXH_ACIBT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pdxH PE=3 SV=2 18 233 4.0E-43
sp|B2I1H7|PDXH_ACIBC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain ACICU) GN=pdxH PE=3 SV=1 18 233 4.0E-43
sp|B7ICC6|PDXH_ACIB5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain AB0057) GN=pdxH PE=3 SV=1 18 233 4.0E-43
sp|A3PIG5|PDXH_RHOS1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pdxH PE=3 SV=1 42 233 4.0E-43
sp|Q20939|PDXH_CAEEL Putative pyridoxamine 5'-phosphate oxidase OS=Caenorhabditis elegans GN=F57B9.1 PE=3 SV=2 34 233 6.0E-43
sp|Q0BVM8|PDXH_GRABC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pdxH PE=3 SV=1 35 215 7.0E-43
sp|A4Y5Z1|PDXH_SHEPC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pdxH PE=3 SV=1 34 233 1.0E-42
sp|Q163Z1|PDXH_ROSDO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pdxH PE=3 SV=1 34 233 1.0E-42
sp|A1SEM4|PDXH_NOCSJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=pdxH PE=3 SV=1 26 233 2.0E-42
sp|A5VFM5|PDXH_SPHWW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=pdxH PE=3 SV=1 26 215 2.0E-42
sp|A8H5G0|PDXH_SHEPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pdxH PE=3 SV=1 21 233 3.0E-42
sp|Q5QTW7|PDXH_IDILO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pdxH PE=3 SV=1 31 233 3.0E-42
sp|B0TQX6|PDXH_SHEHH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pdxH PE=3 SV=1 35 233 7.0E-42
sp|Q2N6B2|PDXH_ERYLH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Erythrobacter litoralis (strain HTCC2594) GN=pdxH PE=3 SV=1 35 219 7.0E-42
sp|A7HR80|PDXH_PARL1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=pdxH PE=3 SV=1 35 233 9.0E-42
sp|B3PSA1|PDXH_RHIE6 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium etli (strain CIAT 652) GN=pdxH PE=3 SV=1 30 233 1.0E-41
sp|B5ZSU2|PDXH_RHILW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pdxH PE=3 SV=1 30 233 2.0E-41
sp|Q2GJ82|PDXH_ANAPZ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Anaplasma phagocytophilum (strain HZ) GN=pdxH PE=3 SV=1 30 219 2.0E-41
sp|Q2KBN4|PDXH_RHIEC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pdxH PE=3 SV=1 30 233 3.0E-41
sp|Q1MKJ4|PDXH_RHIL3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pdxH PE=3 SV=1 30 233 3.0E-41
sp|Q0S6R1|PDXH_RHOJR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodococcus jostii (strain RHA1) GN=pdxH PE=3 SV=2 42 233 5.0E-41
sp|Q0C3Z2|PDXH_HYPNA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Hyphomonas neptunium (strain ATCC 15444) GN=pdxH PE=3 SV=1 26 233 6.0E-41
sp|Q492T8|PDXH_BLOPB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Blochmannia pennsylvanicus (strain BPEN) GN=pdxH PE=3 SV=1 35 233 2.0E-40
sp|Q7MU50|PDXH_PORGI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pdxH PE=3 SV=1 26 233 2.0E-40
sp|B2RHS7|PDXH_PORG3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=pdxH PE=3 SV=1 26 233 2.0E-40
sp|Q87DU7|PDXH_XYLFT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pdxH PE=3 SV=1 39 213 6.0E-40
sp|Q5PBF2|PDXH_ANAMM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Anaplasma marginale (strain St. Maries) GN=pdxH PE=3 SV=2 31 217 6.0E-40
sp|A0QBI8|PDXH_MYCA1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium avium (strain 104) GN=pdxH PE=3 SV=1 39 212 1.0E-39
sp|Q742K7|PDXH_MYCPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pdxH PE=3 SV=1 39 212 1.0E-39
sp|Q5H3H2|PDXH_XANOR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pdxH PE=3 SV=1 39 213 2.0E-39
sp|Q2P6C7|PDXH_XANOM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pdxH PE=3 SV=1 39 213 2.0E-39
sp|Q28PH0|PDXH_JANSC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Jannaschia sp. (strain CCS1) GN=pdxH PE=3 SV=1 42 233 2.0E-39
sp|Q3BQS3|PDXH_XANC5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pdxH PE=3 SV=1 39 213 2.0E-39
sp|A0R420|PDXH_MYCS2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pdxH PE=3 SV=1 39 212 2.0E-39
sp|Q9PDP2|PDXH_XYLFA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xylella fastidiosa (strain 9a5c) GN=pdxH PE=3 SV=1 39 213 3.0E-39
sp|A3Q628|PDXH_MYCSJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium sp. (strain JLS) GN=pdxH PE=3 SV=1 39 212 3.0E-39
sp|Q8D2L7|PDXH_WIGBR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Wigglesworthia glossinidia brevipalpis GN=pdxH PE=3 SV=1 34 233 5.0E-39
sp|Q1B3H2|PDXH_MYCSS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium sp. (strain MCS) GN=pdxH PE=3 SV=1 39 212 5.0E-39
sp|A1ULM8|PDXH_MYCSK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium sp. (strain KMS) GN=pdxH PE=3 SV=1 39 212 5.0E-39
sp|Q8P6X5|PDXH_XANCP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pdxH PE=3 SV=1 39 213 6.0E-39
sp|Q4UX84|PDXH_XANC8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pdxH PE=3 SV=1 39 213 6.0E-39
sp|Q8PI89|PDXH_XANAC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pdxH PE=3 SV=1 39 213 6.0E-39
sp|Q2IHV2|PDXH_ANADE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pdxH PE=3 SV=1 66 233 1.0E-38
sp|Q7VR53|PDXH_BLOFL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Blochmannia floridanus GN=pdxH PE=3 SV=1 29 233 1.0E-38
sp|A4T792|PDXH_MYCGI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium gilvum (strain PYR-GCK) GN=pdxH PE=3 SV=1 39 212 1.0E-38
sp|Q5LRI7|PDXH_RUEPO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pdxH PE=3 SV=2 42 233 2.0E-38
sp|Q9RNP3|PDXH_ZYMMO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdxH PE=3 SV=1 31 218 1.0E-37
sp|O33065|PDXH_MYCLE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium leprae (strain TN) GN=pdxH PE=3 SV=1 39 212 2.0E-37
sp|A1WXY4|PDXH_HALHL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pdxH PE=3 SV=1 26 218 2.0E-37
sp|Q5Z236|PDXH_NOCFA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nocardia farcinica (strain IFM 10152) GN=pdxH PE=3 SV=2 39 233 8.0E-37
sp|P9WIJ1|PDXH_MYCTU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pdxH PE=1 SV=1 39 212 8.0E-36
sp|P9WIJ0|PDXH_MYCTO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pdxH PE=3 SV=1 39 212 8.0E-36
sp|A5U5V8|PDXH_MYCTA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pdxH PE=3 SV=1 39 212 8.0E-36
sp|C1AF78|PDXH_MYCBT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pdxH PE=3 SV=1 39 212 8.0E-36
sp|A1KLV7|PDXH_MYCBP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pdxH PE=3 SV=1 39 212 8.0E-36
sp|P65683|PDXH_MYCBO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pdxH PE=3 SV=1 39 212 8.0E-36
sp|A1B0C6|PDXH_PARDP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Paracoccus denitrificans (strain Pd 1222) GN=pdxH PE=3 SV=1 42 233 2.0E-35
sp|A1TF46|PDXH_MYCVP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pdxH PE=3 SV=1 39 212 8.0E-34
sp|Q0A757|PDXH_ALKEH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pdxH PE=3 SV=1 38 213 5.0E-33
sp|Q51793|PHZG_PSEFL Phenazine biosynthesis protein PhzG OS=Pseudomonas fluorescens GN=phzG PE=1 SV=1 30 233 2.0E-25
sp|Q51521|PHZD_PSECL Phenazine biosynthesis protein PhzD OS=Pseudomonas chlororaphis GN=phzD PE=3 SV=1 35 233 1.0E-23
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|102330
MDVIISSSPGKIKVLPHLQYETHDHMSPSTVNPSPTEQFEKWFQEAIETGVQEPEAMSLSTVSPSGIPSARIVLL
KQVDPRGFVFYTNYTSRKSSEITSNPHAALVLYWREVHRSVRIVGRVEKLSRAESDEYYRSRPIGSKLGAWASKQ
STVIDEHTLEDRMKKVKEKFRVKDGDEETEVPLPEFWGGWRVIPHEVEFWSGKPSRLHDRIRYLRVDGSPEEQPQ
WKIDRLSP*
Coding >Agabi119p4|102330
ATGGACGTCATCATCTCTTCCTCTCCCGGAAAGATCAAAGTCCTCCCTCACCTTCAGTACGAAACGCATGATCAT
ATGTCGCCTTCCACTGTCAACCCGTCTCCGACTGAACAATTCGAGAAATGGTTCCAGGAGGCCATAGAGACCGGT
GTTCAGGAGCCCGAAGCCATGTCGCTCTCCACTGTCTCGCCATCTGGCATTCCGTCAGCAAGGATCGTTTTATTA
AAACAAGTCGATCCGCGTGGTTTCGTTTTCTATACCAATTACACCTCGAGGAAATCCAGCGAGATTACGTCCAAC
CCTCATGCCGCATTAGTACTCTACTGGAGGGAAGTTCACAGGTCTGTGCGTATAGTAGGCAGAGTAGAGAAGCTT
TCCCGAGCGGAGAGCGATGAATATTACCGAAGTAGGCCTATCGGAAGCAAGCTGGGCGCGTGGGCGAGTAAGCAG
AGTACGGTGATTGATGAACATACATTGGAAGATCGCATGAAGAAGGTGAAAGAAAAATTTAGAGTCAAAGACGGA
GATGAAGAGACCGAGGTTCCTCTCCCAGAATTTTGGGGAGGTTGGAGAGTGATACCACATGAGGTTGAGTTTTGG
TCTGGAAAACCATCACGCTTGCACGACCGCATACGATACCTTCGAGTAGACGGCTCGCCAGAAGAGCAGCCGCAG
TGGAAGATTGATAGATTATCACCATGA
Transcript >Agabi119p4|102330
ATGGACGTCATCATCTCTTCCTCTCCCGGAAAGATCAAAGTCCTCCCTCACCTTCAGTACGAAACGCATGATCAT
ATGTCGCCTTCCACTGTCAACCCGTCTCCGACTGAACAATTCGAGAAATGGTTCCAGGAGGCCATAGAGACCGGT
GTTCAGGAGCCCGAAGCCATGTCGCTCTCCACTGTCTCGCCATCTGGCATTCCGTCAGCAAGGATCGTTTTATTA
AAACAAGTCGATCCGCGTGGTTTCGTTTTCTATACCAATTACACCTCGAGGAAATCCAGCGAGATTACGTCCAAC
CCTCATGCCGCATTAGTACTCTACTGGAGGGAAGTTCACAGGTCTGTGCGTATAGTAGGCAGAGTAGAGAAGCTT
TCCCGAGCGGAGAGCGATGAATATTACCGAAGTAGGCCTATCGGAAGCAAGCTGGGCGCGTGGGCGAGTAAGCAG
AGTACGGTGATTGATGAACATACATTGGAAGATCGCATGAAGAAGGTGAAAGAAAAATTTAGAGTCAAAGACGGA
GATGAAGAGACCGAGGTTCCTCTCCCAGAATTTTGGGGAGGTTGGAGAGTGATACCACATGAGGTTGAGTTTTGG
TCTGGAAAACCATCACGCTTGCACGACCGCATACGATACCTTCGAGTAGACGGCTCGCCAGAAGAGCAGCCGCAG
TGGAAGATTGATAGATTATCACCATGA
Gene >Agabi119p4|102330
ATGGACGTCATCATCTCTTCCTCTCCCGGAAAGATCAAAGTCCTCCCTCACCTTCAGTACGAAACGCATGATCAT
ATGTCGCCTTCCACTGTCAACCCGTCTCCGACTGAACAATTCGAGAAATGGTTCCAGGAGGCCATAGAGACCGGT
GTTCAGGAGCCCGAAGCCATGTCGCTCTCCACTGTCTCGCCATCTGGCATTCCGTCAGCAAGGATCGTTTTATTA
AAACAAGTCGATCCGCGTGGTTTCGTTTTCTATACCAATTACACCTCGAGGAAATCCAGCGAGATTACGTCCAAC
CCTCATGCCGCATTAGTACTCTACTGGAGGGAAGTTCACAGGTCTGTGCGTATAGTAGGCAGAGTAGAGAAGCTT
TCCCGAGCGGAGAGCGATGAATATTACCGAAGTAGGCCTATCGGAAGCAAGCTGGGCGCGTGGGCGAGTAAGCAG
AGTACGGTGATTGATGAACATACATTGGAAGATCGCATGAAGAAGGTGAAAGAAAAATTTAGAGTCAAAGACGGA
GATGAAGAGACCGAGGTTCCTCTCCCAGAATTTTGGGGAGGTTGGAGAGTGATACCACAGTTTGTCAATTAATAT
GATCGTCAAAGTTCGTGTTCTAACATCAGCGCAGTGAGGTTGAGTTTTGGTCTGGAAAACCATCACGCTTGCACG
ACCGCATACGATACCTTCGAGTAGACGGCTCGCCAGAAGAGCAGCCGCAGTGGAAGATTGATAGATTATCACCAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail