Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|102320
Gene name
Locationscaffold_07:1209835..1213152
Strand-
Gene length (bp)3317
Transcript length (bp)2937
Coding sequence length (bp)2937
Protein length (aa) 979

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01344 Kelch_1 Kelch motif 2.0E-05 141 181
PF13415 Kelch_3 Galactose oxidase, central domain 2.1E-06 32 82

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15258|RAL2_SCHPO Protein ral2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ral2 PE=1 SV=1 15 597 1.0E-83
sp|Q5ADT1|MDS3_CANAL Negative regulator of sporulation MDS3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDS3 PE=1 SV=1 44 374 3.0E-15
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 33 175 7.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 33 175 7.0E-12
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 33 175 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15258|RAL2_SCHPO Protein ral2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ral2 PE=1 SV=1 15 597 1.0E-83
sp|Q5ADT1|MDS3_CANAL Negative regulator of sporulation MDS3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDS3 PE=1 SV=1 44 374 3.0E-15
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 33 175 7.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 33 175 7.0E-12
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 33 175 2.0E-11
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 15 134 9.0E-11
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 14 161 2.0E-10
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 14 180 2.0E-10
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 14 161 2.0E-10
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 14 180 4.0E-10
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 34 175 7.0E-10
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 34 175 2.0E-09
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 14 175 3.0E-09
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 17 155 1.0E-08
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 16 204 2.0E-08
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 5 204 2.0E-08
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 27 180 2.0E-08
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 14 161 2.0E-08
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 13 159 5.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 27 161 7.0E-08
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 14 161 8.0E-08
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 17 183 1.0E-07
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 15 180 2.0E-07
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 17 122 3.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 25 182 4.0E-07
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 17 183 5.0E-07
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 12 182 5.0E-07
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 12 182 5.0E-07
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 17 182 6.0E-07
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 4 180 6.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 33 182 6.0E-07
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 16 187 7.0E-07
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 4 180 1.0E-06
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 12 182 1.0E-06
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 13 281 1.0E-06
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 12 182 1.0E-06
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 5 186 2.0E-06
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 13 160 2.0E-06
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 19 179 2.0E-06
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 19 178 3.0E-06
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 19 179 3.0E-06
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 17 180 6.0E-06
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 5 204 6.0E-06
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 16 180 9.0E-06
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 11 182 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|102320
MLHSIYDLTTLCRKTTGDVPPKLVGASTTVVGSKMYLFGGRLVTERRMTSDLYMFDLETFDWEYIQPFPEDSAPR
PRYFHSTDSWNNHLVLFGGMSNRPDSPNPEDLCVLSDVRFFDLETRHWLPEESSDTSLEDPNIPRARYAHLSSVT
SNRLFIIGGQDFFNTWLDDVCVYDLVKRSWVQRRDYPRHCGTYRSVAVASTSIVRIPKDEAQASRSLSALGPPGT
RFRMDKTAPLTEITPSNTLTHLSYTADPTDEHPSEIFLYSNYNFTDVKRELEVFSPSPDVDFTIEDRSDHMTGST
LPPGLRFPTGAVLGTYLIIAGTYLAHSYQSFSIWVLDLVSMTWSRIDPGKAIETGSWFRGCLWAEGNKFLIFGNR
NGNLVDDYNHRLLSWDHVAVIDLEAFGIYQPPSLKVDIRMQELGLAALEERCLTDFEIVCDDGRKIPCSRKLLEE
RWPWFELQRTQMLQRAQAALSRLPASAMHAELPTIPGTASVGDTQLDPRLTPRQLFLSEPWPVTMALLQYFYSMA
LITPLQHSPAVLSQLLILGATYQLDHLVSLVKHAMHGALTNSTSVGVYEVATLCSCRSLQIRALKTVMSYTQKKP
PKSRQDKDKDNGNDRHSGDSGGPNGANGKNDNSHDDGGGGAFSSRPRGTSDARWRTLGGSGAPSGTSYVSRGGNI
PSPPVKKSDSQKSRERSLTTPVAYRPPCSVPSLMHGPKRQSILEPSLSPSRTRENHAPAENLRTHRRSHSSKASD
EWHKASPATGMSLQKSLPMTPKIQTTSHYTGINKPVSPTSLIKTSIRSKSPTTPTRQRPSPILTDITGRNIMILA
ERTHHTPNSSSSSSRSSFSSTNHILKTPITSYSKGMNPKVSDYSTRHNGNGTEDGFTIVPSGDEAVHTPDLQPSP
TRAKWTVHHRSNSSLDSSPQSKPHLPQKTLPFAPFSPTTQSLLASRVQLDSRRTKPNNYPGPNHDATTIFGDSQS
QPV*
Coding >Agabi119p4|102320
ATGCTTCACTCTATCTATGATCTAACTACTCTTTGCCGTAAAACAACCGGGGATGTTCCTCCAAAGCTGGTGGGT
GCCTCTACGACCGTAGTAGGCTCTAAAATGTATCTTTTCGGAGGTCGCTTAGTTACTGAGCGACGAATGACGTCT
GACCTGTACATGTTTGACCTGGAAACTTTTGACTGGGAATACATTCAACCTTTCCCCGAAGACAGTGCCCCGCGG
CCTCGGTATTTCCATAGTACTGATTCTTGGAACAACCATCTCGTCCTCTTCGGTGGTATGAGCAATCGGCCGGAC
TCACCAAACCCGGAGGACCTTTGCGTTCTCAGCGATGTCCGCTTTTTTGACCTTGAAACTCGTCACTGGTTGCCC
GAAGAATCATCAGACACGTCACTTGAGGATCCCAATATTCCGCGTGCTCGCTATGCCCACCTATCTTCTGTGACT
TCTAACCGCCTCTTCATCATCGGAGGTCAAGATTTTTTCAATACCTGGTTGGATGACGTCTGCGTTTATGACCTC
GTGAAGAGAAGTTGGGTCCAAAGACGAGATTATCCTCGGCACTGCGGTACTTATCGCAGTGTCGCCGTTGCCTCA
ACATCGATAGTTCGCATACCCAAAGACGAGGCTCAAGCTTCCCGTTCGCTCTCGGCGCTCGGCCCTCCTGGAACT
AGATTTCGGATGGACAAGACGGCGCCGCTGACAGAAATTACTCCATCAAACACTCTCACACATCTCTCCTACACC
GCCGATCCGACTGATGAGCATCCCAGTGAAATCTTTTTGTACAGTAATTACAATTTTACCGATGTCAAACGAGAG
CTCGAAGTATTTTCTCCCTCACCCGACGTTGATTTCACAATTGAGGACCGCTCCGACCATATGACAGGCTCCACT
CTTCCTCCTGGTCTTCGTTTCCCCACAGGCGCCGTTCTCGGCACATATCTCATCATCGCTGGTACCTATCTTGCC
CACAGTTATCAATCGTTTTCCATCTGGGTATTGGACCTAGTGTCAATGACCTGGTCTCGCATTGACCCCGGAAAG
GCGATTGAAACTGGCTCTTGGTTTAGGGGCTGCCTTTGGGCGGAAGGCAATAAATTCCTCATTTTCGGGAATAGG
AATGGGAACTTGGTTGATGATTATAATCATCGGTTGTTGAGTTGGGACCATGTCGCAGTCATTGACTTGGAGGCG
TTTGGAATTTATCAGCCGCCTTCACTTAAGGTTGATATTCGTATGCAAGAACTTGGCCTTGCGGCTCTTGAGGAG
AGGTGCCTAACTGATTTCGAGATTGTTTGCGATGACGGACGAAAGATACCTTGTTCTCGAAAACTTCTCGAAGAA
CGTTGGCCCTGGTTCGAACTGCAGCGAACGCAAATGTTACAAAGAGCTCAGGCTGCATTGAGCCGCCTGCCAGCT
TCCGCTATGCATGCCGAGCTTCCTACTATCCCTGGTACAGCTAGTGTGGGAGACACTCAACTTGATCCTCGTCTC
ACTCCTCGCCAGCTCTTTTTATCAGAGCCGTGGCCAGTTACGATGGCCTTGCTACAGTACTTCTATTCGATGGCT
CTTATCACCCCGCTCCAGCATAGTCCTGCGGTTTTGAGTCAGTTACTGATCCTTGGAGCGACCTATCAGTTAGAC
CACCTAGTATCGCTTGTGAAACACGCAATGCACGGGGCTCTCACAAATTCGACGTCAGTGGGCGTATATGAAGTT
GCTACTCTATGCAGCTGTAGAAGTCTGCAAATCAGAGCCCTCAAGACCGTGATGTCATATACCCAGAAGAAACCG
CCGAAATCTCGACAAGACAAGGACAAGGACAATGGGAATGACCGACATTCCGGAGACTCGGGTGGGCCTAACGGA
GCAAATGGCAAAAACGACAACTCTCACGATGATGGTGGTGGTGGTGCTTTCTCTTCTCGGCCAAGAGGAACTTCA
GACGCGCGTTGGAGAACACTTGGCGGTAGCGGTGCACCCAGCGGCACCTCGTATGTATCTCGGGGTGGTAATATA
CCCTCCCCTCCTGTGAAAAAATCAGATTCTCAAAAGAGCCGTGAGAGATCGCTCACAACTCCAGTGGCATATCGA
CCTCCGTGTTCCGTTCCTTCTTTGATGCATGGGCCCAAGCGTCAGTCAATTCTTGAGCCAAGCTTATCACCATCA
CGGACGCGAGAGAACCATGCGCCAGCAGAGAATCTCAGAACGCATCGCCGCTCTCACTCATCCAAGGCTTCTGAT
GAGTGGCATAAAGCTTCTCCTGCCACAGGAATGTCCTTGCAGAAATCGCTACCGATGACGCCTAAAATACAAACG
ACTTCTCACTATACGGGTATCAACAAACCCGTGAGCCCGACTTCGCTAATCAAGACTAGCATACGTTCGAAATCG
CCCACCACACCTACACGACAGAGGCCTTCGCCCATATTAACAGATATTACCGGGCGTAATATCATGATTCTTGCT
GAACGTACGCATCATACCCCGAATTCAAGTTCCTCCAGCTCGCGAAGTTCTTTTTCATCTACCAACCATATACTG
AAGACGCCCATAACGTCATACAGTAAAGGAATGAATCCCAAAGTATCTGATTACTCGACAAGGCACAACGGGAAC
GGCACGGAAGATGGTTTTACGATAGTTCCAAGTGGAGACGAAGCAGTCCATACCCCCGATCTACAACCAAGTCCG
ACACGTGCCAAATGGACAGTACATCACCGTTCCAACTCCTCCCTCGACTCTTCACCCCAATCCAAGCCACATCTA
CCACAGAAGACCTTGCCATTTGCCCCATTCAGTCCAACCACCCAATCACTCCTGGCCAGTCGGGTTCAGCTAGAT
AGCAGAAGAACAAAACCGAACAATTATCCTGGCCCTAACCACGACGCCACCACAATTTTCGGGGACAGCCAATCC
CAGCCTGTATAA
Transcript >Agabi119p4|102320
ATGCTTCACTCTATCTATGATCTAACTACTCTTTGCCGTAAAACAACCGGGGATGTTCCTCCAAAGCTGGTGGGT
GCCTCTACGACCGTAGTAGGCTCTAAAATGTATCTTTTCGGAGGTCGCTTAGTTACTGAGCGACGAATGACGTCT
GACCTGTACATGTTTGACCTGGAAACTTTTGACTGGGAATACATTCAACCTTTCCCCGAAGACAGTGCCCCGCGG
CCTCGGTATTTCCATAGTACTGATTCTTGGAACAACCATCTCGTCCTCTTCGGTGGTATGAGCAATCGGCCGGAC
TCACCAAACCCGGAGGACCTTTGCGTTCTCAGCGATGTCCGCTTTTTTGACCTTGAAACTCGTCACTGGTTGCCC
GAAGAATCATCAGACACGTCACTTGAGGATCCCAATATTCCGCGTGCTCGCTATGCCCACCTATCTTCTGTGACT
TCTAACCGCCTCTTCATCATCGGAGGTCAAGATTTTTTCAATACCTGGTTGGATGACGTCTGCGTTTATGACCTC
GTGAAGAGAAGTTGGGTCCAAAGACGAGATTATCCTCGGCACTGCGGTACTTATCGCAGTGTCGCCGTTGCCTCA
ACATCGATAGTTCGCATACCCAAAGACGAGGCTCAAGCTTCCCGTTCGCTCTCGGCGCTCGGCCCTCCTGGAACT
AGATTTCGGATGGACAAGACGGCGCCGCTGACAGAAATTACTCCATCAAACACTCTCACACATCTCTCCTACACC
GCCGATCCGACTGATGAGCATCCCAGTGAAATCTTTTTGTACAGTAATTACAATTTTACCGATGTCAAACGAGAG
CTCGAAGTATTTTCTCCCTCACCCGACGTTGATTTCACAATTGAGGACCGCTCCGACCATATGACAGGCTCCACT
CTTCCTCCTGGTCTTCGTTTCCCCACAGGCGCCGTTCTCGGCACATATCTCATCATCGCTGGTACCTATCTTGCC
CACAGTTATCAATCGTTTTCCATCTGGGTATTGGACCTAGTGTCAATGACCTGGTCTCGCATTGACCCCGGAAAG
GCGATTGAAACTGGCTCTTGGTTTAGGGGCTGCCTTTGGGCGGAAGGCAATAAATTCCTCATTTTCGGGAATAGG
AATGGGAACTTGGTTGATGATTATAATCATCGGTTGTTGAGTTGGGACCATGTCGCAGTCATTGACTTGGAGGCG
TTTGGAATTTATCAGCCGCCTTCACTTAAGGTTGATATTCGTATGCAAGAACTTGGCCTTGCGGCTCTTGAGGAG
AGGTGCCTAACTGATTTCGAGATTGTTTGCGATGACGGACGAAAGATACCTTGTTCTCGAAAACTTCTCGAAGAA
CGTTGGCCCTGGTTCGAACTGCAGCGAACGCAAATGTTACAAAGAGCTCAGGCTGCATTGAGCCGCCTGCCAGCT
TCCGCTATGCATGCCGAGCTTCCTACTATCCCTGGTACAGCTAGTGTGGGAGACACTCAACTTGATCCTCGTCTC
ACTCCTCGCCAGCTCTTTTTATCAGAGCCGTGGCCAGTTACGATGGCCTTGCTACAGTACTTCTATTCGATGGCT
CTTATCACCCCGCTCCAGCATAGTCCTGCGGTTTTGAGTCAGTTACTGATCCTTGGAGCGACCTATCAGTTAGAC
CACCTAGTATCGCTTGTGAAACACGCAATGCACGGGGCTCTCACAAATTCGACGTCAGTGGGCGTATATGAAGTT
GCTACTCTATGCAGCTGTAGAAGTCTGCAAATCAGAGCCCTCAAGACCGTGATGTCATATACCCAGAAGAAACCG
CCGAAATCTCGACAAGACAAGGACAAGGACAATGGGAATGACCGACATTCCGGAGACTCGGGTGGGCCTAACGGA
GCAAATGGCAAAAACGACAACTCTCACGATGATGGTGGTGGTGGTGCTTTCTCTTCTCGGCCAAGAGGAACTTCA
GACGCGCGTTGGAGAACACTTGGCGGTAGCGGTGCACCCAGCGGCACCTCGTATGTATCTCGGGGTGGTAATATA
CCCTCCCCTCCTGTGAAAAAATCAGATTCTCAAAAGAGCCGTGAGAGATCGCTCACAACTCCAGTGGCATATCGA
CCTCCGTGTTCCGTTCCTTCTTTGATGCATGGGCCCAAGCGTCAGTCAATTCTTGAGCCAAGCTTATCACCATCA
CGGACGCGAGAGAACCATGCGCCAGCAGAGAATCTCAGAACGCATCGCCGCTCTCACTCATCCAAGGCTTCTGAT
GAGTGGCATAAAGCTTCTCCTGCCACAGGAATGTCCTTGCAGAAATCGCTACCGATGACGCCTAAAATACAAACG
ACTTCTCACTATACGGGTATCAACAAACCCGTGAGCCCGACTTCGCTAATCAAGACTAGCATACGTTCGAAATCG
CCCACCACACCTACACGACAGAGGCCTTCGCCCATATTAACAGATATTACCGGGCGTAATATCATGATTCTTGCT
GAACGTACGCATCATACCCCGAATTCAAGTTCCTCCAGCTCGCGAAGTTCTTTTTCATCTACCAACCATATACTG
AAGACGCCCATAACGTCATACAGTAAAGGAATGAATCCCAAAGTATCTGATTACTCGACAAGGCACAACGGGAAC
GGCACGGAAGATGGTTTTACGATAGTTCCAAGTGGAGACGAAGCAGTCCATACCCCCGATCTACAACCAAGTCCG
ACACGTGCCAAATGGACAGTACATCACCGTTCCAACTCCTCCCTCGACTCTTCACCCCAATCCAAGCCACATCTA
CCACAGAAGACCTTGCCATTTGCCCCATTCAGTCCAACCACCCAATCACTCCTGGCCAGTCGGGTTCAGCTAGAT
AGCAGAAGAACAAAACCGAACAATTATCCTGGCCCTAACCACGACGCCACCACAATTTTCGGGGACAGCCAATCC
CAGCCTGTATAA
Gene >Agabi119p4|102320
ATGCTTCACTCTATCTATGATCTAACTACTCTTTGCCGTAAAACAACCGGGGATGTTCCTCCAAAGCTGGTGGTA
CGTGTCCTATCCTCACGCGTACAAACAGCAGGGAGTCGATTCTTCTGCTGAACAGGGTGCCTCTACGACCGTAGT
AGGCTCTAAAATGTATCTTTTCGTGAGGACTTCCCCATTGCAACTGTGTGTCCAAAATTTCGCTCATACTCGCTA
GGGAGGTCGCTTAGTTACTGAGCGACGAATGACGTCTGACCTGTACATGTTTGACCTGGAAACTTTTGACTGGGA
ATACATTCAACCTTTCCCCGAAGACAGTGCCCCGCGGCCTCGGTATTTCCATAGTACTGATTCTTGTGAGTGCAG
TCATGTGGAGCACCATCTTGTAATTGATTTTTTAATATGTTAGGGAACAACCATCTCGTCCTCTTCGGTGGTATG
AGCAATCGGCCGGACTCACCAAACCCGGAGGACCTTTGCGTTCTCAGCGATGTCCGCTTTTTTGACCTTGAAACT
CGTCACTGGTTGCCCGAAGAATCATCAGACACGTCACTTGAGGATCCCAATATTCCGCGTGCTCGCTATGCCCAC
CTATCTTCTGTGACTTCTAACCGCCTCTTCATCATCGGAGGTCAAGATTTTTTCAATACCTGGTTGGATGACGTC
TGCGTTTATGACCTCGTGAAGAGAAGTTGGGTCCAAAGACGAGATTATCCTCGGCACTGCGGTACTTATCGCAGT
GTCGCCGTTGCCTCAACATCGATAGTTCGCATACCCAAAGACGAGGCTCAAGCTTCCCGTTCGCTCTCGGCGCTC
GGCCCTCCTGGAACTAGATTTCGGATGGACAAGACGGCGCCGCTGACAGAAATTACTCCATCAAACACTCTCACA
CATCTCTCCTACACCGCCGATCCGACTGATGAGCATCCCAGTGAAATCTTTTTGTACAGTAATTACAATGTGGGT
TATCTTTCATCTTACTACTTGATGCTAATTTGCGATTGAATTTCAAATACAGTTTACCGATGTCAAACGAGAGCT
CGAAGTATTTTCTCCCTCACCCGACGTTGATTTCACAATTGAGGACCGCTCCGACCATATGACAGGCTCCACTCT
TCCTCCTGGTCTTCGTTTCCCCACAGGCGCCGTTCTCGGCACATATCTCATCATCGCTGGTACCTATCTTGCCCA
CAGTTATCAATCGTTTTCCATCTGGGTATTGGACCTAGTGTCAATGACCTGGTCTCGCATTGACCCCGGAAAGGC
GATTGAAACTGGCTCTTGGTTTAGGGGCTGCCTTTGGGCGGAAGGCAATAAATTCCTCATTTTCGGGAATAGGAA
TGGGAACTTGGTTGATGATTATAATCATCGGTTGTTGAGTTGGGACCATGTCGCAGTCATTGACTTGGAGGCGTT
TGGAATTTATCAGCCGCCTTCACTTAAGGTTGATATTCGTATGCAAGAACTTGGCCTTGCGGCTCTTGAGGAGAG
GTGCCTAACTGATTTCGAGATTGTTTGCGATGACGGACGAAAGATACCTTGTTCTCGAAAACTTCTCGAAGAACG
TTGGCCCTGGTTCGAACTGCAGCGAACGCAAATGTTACAAAGAGCTCAGGCTGCATTGAGCCGCCTGCCAGCTTC
CGCTATGCATGCCGAGCTTCCTACTATCCCTGGTACAGCTAGTGTGGGAGACACTCAACTTGATCCTCGTCTCAC
TCCTCGCCAGCTCTTTTTATCAGAGCCGTGGCCAGTTACGATGGCCTTGCTACAGTACTTCTATTCGATGGCTCT
TATCACCCCGCTCCAGCATAGTCCTGCGGTTTTGAGTCAGTTACTGATCCTTGGAGCGACCTATCAGTTAGACCA
CCTAGTATCGCTTGTGAAACACGCAATGCACGGGGCTCTCACAAATTCGACGTCAGTGGGCGTATATGAAGTTGC
TACTCTATGCAGCTGTAGAAGTCTGCAAATCAGGCTAGTTTTTTCAAATAAAATTCAAGCTGATCAACTAAGTAA
TCCACTCTTATAGAGCCCTCAAGACCGTGATGGTGCATAAACTCCTCCATTTTCCTGTTAATCACCCTGACATGT
TTTCTCCAGTCATATACCCAGAAGAAACCGCCGAAATCTCGACAAGACAAGGACAAGGACAATGGGAATGACCGA
CATTCCGGAGACTCGGGTGGGCCTAACGGAGCAAATGGCAAAAACGACAACTCTCACGATGATGGTGGTGGTGGT
GCTTTCTCTTCTCGGCCAAGAGGAACTTCAGACGCGCGTTGGAGAACACTTGGCGGTAGCGGTGCACCCAGCGGC
ACCTCGTATGGTGAGGTCTCTCAATGACATATTTCGAATTTGCTAACTTACCAATATTAGTATCTCGGGGTGGTA
ATATACCCTCCCCTCCTGTGAAAAAATCAGATTCTCAAAAGAGCCGTGAGAGATCGCTCACAACTCCAGTGGCAT
ATCGACCTCCGTGTTCCGTTCCTTCTTTGATGCATGGGCCCAAGCGTCAGTCAATTCTTGAGCCAAGCTTATCAC
CATCACGGACGCGAGAGAACCATGCGCCAGCAGAGAATCTCAGAACGCATCGCCGCTCTCACTCATCCAAGGCTT
CTGATGAGTGGCATAAAGCTTCTCCTGCCACAGGAATGTCCTTGCAGAAATCGCTACCGATGACGCCTAAAATAC
AAACGACTTCTCACTATACGGGTATCAACAAACCCGTGAGCCCGACTTCGCTAATCAAGACTAGCATACGTTCGA
AATCGCCCACCACACCTACACGACAGAGGCCTTCGCCCATATTAACAGATATTACCGGGCGTAATATCATGATTC
TTGCTGAACGTACGCATCATACCCCGAATTCAAGTTCCTCCAGCTCGCGAAGTTCTTTTTCATCTACCAACCATA
TACTGAAGACGCCCATAACGTCATACAGTAAAGGAATGAATCCCAAAGTATCTGATTACTCGACAAGGCACAACG
GGAACGGCACGGAAGATGGTTTTACGATAGTTCCAAGTGGAGACGAAGCAGTCCATACCCCCGATCTACAACCAA
GTCCGACACGTGCCAAATGGACAGTACATCACCGTTCCAACTCCTCCCTCGACTCTTCACCCCAATCCAAGCCAC
ATCTACCACAGAAGACCTTGCCATTTGCCCCATTCAGTCCAACCACCCAATCACTCCTGGCCAGTCGGGTTCAGC
TAGATAGCAGAAGAACAAAACCGAACAATTATCCTGGCCCTAACCACGACGCCACCACAATTTTCGGGGACAGCC
AATCCCAGCCTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail