Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|102290
Gene name
Locationscaffold_07:1201544..1202890
Strand-
Gene length (bp)1346
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00498 FHA FHA domain 1.1E-17 199 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5M9G6|SNIP1_RAT Smad nuclear interacting protein 1 OS=Rattus norvegicus GN=Snip1 PE=1 SV=1 121 287 5.0E-52
sp|Q8TAD8|SNIP1_HUMAN Smad nuclear-interacting protein 1 OS=Homo sapiens GN=SNIP1 PE=1 SV=1 132 287 9.0E-52
sp|Q8BIZ6|SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus GN=Snip1 PE=1 SV=1 132 287 1.0E-51
sp|Q8W4D8|DDL_ARATH FHA domain-containing protein DDL OS=Arabidopsis thaliana GN=DDL PE=1 SV=1 134 290 1.0E-46
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 10 288 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5M9G6|SNIP1_RAT Smad nuclear interacting protein 1 OS=Rattus norvegicus GN=Snip1 PE=1 SV=1 121 287 5.0E-52
sp|Q8TAD8|SNIP1_HUMAN Smad nuclear-interacting protein 1 OS=Homo sapiens GN=SNIP1 PE=1 SV=1 132 287 9.0E-52
sp|Q8BIZ6|SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus GN=Snip1 PE=1 SV=1 132 287 1.0E-51
sp|Q8W4D8|DDL_ARATH FHA domain-containing protein DDL OS=Arabidopsis thaliana GN=DDL PE=1 SV=1 134 290 1.0E-46
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 10 288 1.0E-35
sp|Q07930|PML1_YEAST Pre-mRNA leakage protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PML1 PE=1 SV=1 137 275 8.0E-14
sp|Q8R3G1|PP1R8_MOUSE Nuclear inhibitor of protein phosphatase 1 OS=Mus musculus GN=Ppp1r8 PE=1 SV=1 154 284 6.0E-13
sp|Q9BWU0|NADAP_HUMAN Kanadaptin OS=Homo sapiens GN=SLC4A1AP PE=1 SV=1 150 288 7.0E-13
sp|Q12972|PP1R8_HUMAN Nuclear inhibitor of protein phosphatase 1 OS=Homo sapiens GN=PPP1R8 PE=1 SV=2 154 284 7.0E-13
sp|Q28147|PP1R8_BOVIN Nuclear inhibitor of protein phosphatase 1 OS=Bos taurus GN=PPP1R8 PE=1 SV=1 154 284 8.0E-13
sp|Q9Y4F5|C170B_HUMAN Centrosomal protein of 170 kDa protein B OS=Homo sapiens GN=CEP170B PE=1 SV=4 176 284 1.0E-08
sp|Q80U49|C170B_MOUSE Centrosomal protein of 170 kDa protein B OS=Mus musculus GN=Cep170b PE=1 SV=2 176 284 1.0E-08
sp|Q498L0|C170B_XENLA Centrosomal protein of 170 kDa protein B OS=Xenopus laevis GN=cep170b PE=2 SV=1 176 284 3.0E-06
sp|A0JM08|C170B_XENTR Centrosomal protein of 170 kDa protein B OS=Xenopus tropicalis GN=cep170b PE=2 SV=1 176 284 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|102290
MYTRIFFETRIVNSMRDLALHEDVPRTSRNGQDRDRDRKSHSYSDKRREGGHDRIAESSSYGGSHRHRESQYERR
GYGEHDRERERQRDRERYDRDRDGRRDERPSRRRSASPRSRRSSRPRSSSRDRSPNPEKAKPNFNQSGLLAAETN
TVKATDGTSTVLKYNEPPEARKPTLSWRLYVFKGSEQVELLHIQRQSAYLIGRDRLVSDIAVDHPSCSKQHAAIQ
HRYIQDKGTSSGTVKPFVIDLESTNGTFVNDEKIPSARFYELKAGDVIKFGLSNREYVLLNEEAAS*
Coding >Agabi119p4|102290
ATGTATACCCGGATCTTTTTTGAAACACGGATTGTGAACTCCATGCGCGACCTGGCATTACATGAGGATGTACCT
CGTACTTCAAGAAACGGCCAAGACCGTGATCGAGATAGAAAATCTCATAGTTACAGCGACAAAAGAAGGGAGGGG
GGTCATGACCGTATAGCCGAGAGTTCTTCATATGGAGGTTCACACAGGCATCGGGAGTCACAGTATGAGCGCCGA
GGGTACGGGGAACATGACCGGGAACGAGAGCGACAAAGAGATAGGGAGCGCTATGATAGGGATAGAGATGGAAGG
CGTGATGAGCGGCCTTCACGAAGACGCTCGGCTTCGCCGAGATCACGCCGCTCCTCCAGGCCACGGTCATCCTCC
AGAGATCGTTCTCCCAATCCAGAGAAAGCGAAGCCCAATTTCAACCAGTCAGGACTACTAGCTGCAGAAACTAAT
ACCGTAAAGGCAACAGATGGAACCAGTACCGTCCTGAAATATAACGAACCACCGGAAGCTCGAAAACCTACTCTG
AGTTGGAGACTCTATGTTTTTAAAGGTAGTGAACAAGTAGAACTTCTTCATATTCAACGTCAGAGTGCATATCTG
ATTGGACGTGATCGGCTTGTCTCTGACATAGCCGTGGATCACCCCTCATGCTCGAAGCAGCATGCAGCCATTCAG
CATCGATATATCCAGGACAAAGGAACTTCTAGTGGTACTGTGAAGCCCTTCGTTATCGACCTAGAGTCGACGAAC
GGGACATTTGTCAATGATGAAAAGATACCGTCTGCACGTTTTTATGAACTGAAAGCTGGAGATGTCATCAAATTT
GGTCTTTCCAACCGGGAATATGTTTTATTAAACGAGGAAGCGGCTTCGTAA
Transcript >Agabi119p4|102290
ATGTATACCCGGATCTTTTTTGAAACACGGATTGTGAACTCCATGCGCGACCTGGCATTACATGAGGATGTACCT
CGTACTTCAAGAAACGGCCAAGACCGTGATCGAGATAGAAAATCTCATAGTTACAGCGACAAAAGAAGGGAGGGG
GGTCATGACCGTATAGCCGAGAGTTCTTCATATGGAGGTTCACACAGGCATCGGGAGTCACAGTATGAGCGCCGA
GGGTACGGGGAACATGACCGGGAACGAGAGCGACAAAGAGATAGGGAGCGCTATGATAGGGATAGAGATGGAAGG
CGTGATGAGCGGCCTTCACGAAGACGCTCGGCTTCGCCGAGATCACGCCGCTCCTCCAGGCCACGGTCATCCTCC
AGAGATCGTTCTCCCAATCCAGAGAAAGCGAAGCCCAATTTCAACCAGTCAGGACTACTAGCTGCAGAAACTAAT
ACCGTAAAGGCAACAGATGGAACCAGTACCGTCCTGAAATATAACGAACCACCGGAAGCTCGAAAACCTACTCTG
AGTTGGAGACTCTATGTTTTTAAAGGTAGTGAACAAGTAGAACTTCTTCATATTCAACGTCAGAGTGCATATCTG
ATTGGACGTGATCGGCTTGTCTCTGACATAGCCGTGGATCACCCCTCATGCTCGAAGCAGCATGCAGCCATTCAG
CATCGATATATCCAGGACAAAGGAACTTCTAGTGGTACTGTGAAGCCCTTCGTTATCGACCTAGAGTCGACGAAC
GGGACATTTGTCAATGATGAAAAGATACCGTCTGCACGTTTTTATGAACTGAAAGCTGGAGATGTCATCAAATTT
GGTCTTTCCAACCGGGAATATGTTTTATTAAACGAGGAAGCGGCTTCGTAA
Gene >Agabi119p4|102290
ATGTATACCCGGAGTGGCTGCCAAGGACATTTCGCCTACTTCCCGAATCCAGCCTATCATGAGTTTCATCCAGAT
TCCACTGAGTCCCACTCGAACTTGAAGCAGAACGCTAGGTTTCTCACGTGACAGCTTTAACAATTGAACTTCGAC
TTAACAGAGCTCAAACCAAGCTTACATAGTGCCAACTGAACACTTGTCAAGAATTCAACAGTCTTTTTTGAAACA
CGGATTGTGGTGCTCTTTTATATGCAGCTTTCACAACCCACGTATAAGTTGACATAGCTCAAACAGAACTCCATG
CGCGACCTGGCATTACATGAGGATGTACCTCGTACTTCAAGAAACGGCCAAGACCGTGATCGAGATAGAAAATCT
CATAGTTACAGCGACAAAAGAAGGGAGGGGGGTCATGACCGTATAGCCGAGAGTTCTTCATATGGAGGTTCACAC
AGGCATCGGGAGTCACAGTATGAGCGCCGAGGGTACGGGGAACATGACCGGGAACGAGAGCGACAAAGAGATAGG
GAGCGCTATGATAGGGATAGAGATGGAAGGCGTGATGAGCGGCCTTCACGAAGACGCTCGGCTTCGCCGAGATCA
CGCCGCTCCTCCAGGCCACGGTCATCCTCCAGAGATCGTTCTCCCAATCCAGAGAAAGCGAAGCCCAATTTCAAC
CAGTCAGGACTACTAGCTGCAGAAACTAATACCGTAAAGGCAACAGATGGAACCAGTACCGTCCTGAAATATAAC
GAACCACCGGAAGCTCGAAAACCTACTCTGAGTTGGAGACTCTATGTTTTTAAAGGTAGTGAACAAGTAGGTAAG
TCCCAAATTTCCTTTCCCACCTTACCTTCCACGAAATCTTTCCGTTATCAGAACTTCTTCATATTCAACGTCAGA
GTGCATATCTGATTGGACGTGATCGGCTTGTCTCTGACATAGCCGTGGATCACCCCTCATGCTCGAAGCAGCATG
CAGCCATTCAGCGTGAGTGTTGATTATCGGACAGGGCGTGACAAGTCATAAGACCCCTCCAGATCGATATATCCA
GGACAAAGGAACTTCTAGTGGTACTGTGAAGTACGCCAATCACTACGCCAACAAGCTTGATGCTAAATTCACCAT
CATGTTTTTTAGGCCCTTCGTTATCGACCTAGAGTCGACGAACGGGACATTTGTCAATGATGAAAAGATACCGTC
TGCACGTTTTTATGAACTGAAAGCTGGAGATGGTACGTCGATTCTAGTACTCGGAGCACCTGTCACTGATATTGT
CCGTTTTAGTCATCAAATTTGGTCTTTCCAACCGGGAATATGTTTTATTAAACGAGGAAGCGGCTTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail