Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|102240
Gene name
Locationscaffold_07:1189830..1191494
Strand-
Gene length (bp)1664
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 9.5E-44 28 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0XZW5|ABNA_ASPFC Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=abnA PE=3 SV=1 3 309 3.0E-67
sp|Q4WYX7|ABNA_ASPFU Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abnA PE=3 SV=1 3 309 3.0E-67
sp|A1CLG4|ABNA_ASPCL Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=abnA PE=3 SV=1 3 309 2.0E-66
sp|P42256|ABNA_ASPNG Arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus niger GN=abnA PE=1 SV=1 1 309 6.0E-65
sp|A2QT85|ABNA_ASPNC Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abnA PE=3 SV=1 2 309 1.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0XZW5|ABNA_ASPFC Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=abnA PE=3 SV=1 3 309 3.0E-67
sp|Q4WYX7|ABNA_ASPFU Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abnA PE=3 SV=1 3 309 3.0E-67
sp|A1CLG4|ABNA_ASPCL Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=abnA PE=3 SV=1 3 309 2.0E-66
sp|P42256|ABNA_ASPNG Arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus niger GN=abnA PE=1 SV=1 1 309 6.0E-65
sp|A2QT85|ABNA_ASPNC Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abnA PE=3 SV=1 2 309 1.0E-64
sp|A1D5W1|ABNA_NEOFI Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=abnA PE=3 SV=1 3 309 5.0E-63
sp|Q2U8C6|ABNA_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnA PE=3 SV=1 1 309 2.0E-62
sp|B8NDL1|ABNA_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnA PE=3 SV=1 1 309 2.0E-62
sp|Q0CS14|ABNA_ASPTN Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abnA PE=3 SV=1 1 309 1.0E-61
sp|P94522|EABN1_BACSU Extracellular endo-alpha-(1->5)-L-arabinanase 1 OS=Bacillus subtilis (strain 168) GN=abnA PE=1 SV=3 28 307 1.0E-60
sp|Q9HFS9|ABNA_ASPAC Arabinan endo-1,5-alpha-L-arabinosidase A OS=Aspergillus aculeatus GN=abnA PE=1 SV=1 4 309 5.0E-60
sp|Q93HT9|IABN_GEOTD Intracellular endo-alpha-(1->5)-L-arabinanase OS=Geobacillus thermodenitrificans GN=abn-ts PE=1 SV=1 25 288 4.0E-59
sp|Q5BA96|ABNA_EMENI Probable arabinan endo-1,5-alpha-L-arabinosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abnA PE=3 SV=2 8 309 1.0E-57
sp|B3EYM8|IABN_GEOSE Intracellular endo-alpha-(1->5)-L-arabinanase OS=Geobacillus stearothermophilus GN=abnB PE=1 SV=1 25 288 2.0E-57
sp|Q2U1X8|ABNC_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnC PE=3 SV=1 18 309 3.0E-53
sp|B8NMD3|ABNC_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnC PE=3 SV=2 18 309 3.0E-53
sp|B0YDT3|ABNC_ASPFC Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=abnC PE=3 SV=2 4 309 6.0E-49
sp|A1DKY5|ABNC_NEOFI Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=abnC PE=3 SV=1 4 309 7.0E-49
sp|Q4W930|ABNC_ASPFU Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abnC PE=3 SV=2 4 309 6.0E-48
sp|A1CN18|ABNC_ASPCL Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=abnC PE=3 SV=1 4 309 2.0E-47
sp|P95470|ARBA_CELJU Extracellular exo-alpha-(1->5)-L-arabinofuranosidase ArbA OS=Cellvibrio japonicus (strain Ueda107) GN=arbA PE=1 SV=1 31 309 1.0E-45
sp|A5AAG2|ABNC_ASPNC Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abnC PE=3 SV=1 4 309 1.0E-43
sp|Q5AZC8|ABNB_EMENI Arabinan endo-1,5-alpha-L-arabinosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abnB PE=2 SV=1 32 310 4.0E-42
sp|B8N803|ABNB_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnB PE=3 SV=2 1 309 2.0E-40
sp|Q5AUM3|ABNC_EMENI Arabinan endo-1,5-alpha-L-arabinosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abnC PE=2 SV=1 22 309 2.0E-39
sp|Q0CRJ6|ABNC_ASPTN Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abnC PE=3 SV=1 9 309 2.0E-39
sp|Q0CY27|ABNB_ASPTN Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abnB PE=3 SV=2 22 308 7.0E-38
sp|Q2UI74|ABNB_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnB PE=3 SV=1 1 305 1.0E-37
sp|Q4X0A5|ABNB_ASPFU Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abnB PE=3 SV=2 22 287 4.0E-33
sp|B0XTS5|ABNB_ASPFC Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=abnB PE=3 SV=2 22 287 8.0E-33
sp|A1DHW8|ABNB_NEOFI Probable arabinan endo-1,5-alpha-L-arabinosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=abnB PE=3 SV=2 22 287 2.0E-32
sp|Q5B8T6|ABND_EMENI Probable arabinan endo-1,5-alpha-L-arabinosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abnD PE=2 SV=2 26 308 8.0E-29
sp|A5IKD4|EABN_THEP1 Extracellular endo-alpha-(1->5)-L-arabinanase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0637 PE=1 SV=1 1 257 3.0E-15
sp|P42293|EABN2_BACSU Extracellular endo-alpha-(1->5)-L-arabinanase 2 OS=Bacillus subtilis (strain 168) GN=abn2 PE=1 SV=2 2 275 4.0E-11
sp|P07129|XYNB_BACPU Beta-xylosidase OS=Bacillus pumilus GN=xynB PE=1 SV=2 33 310 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|102240
MRSLFALALLSFASLGYAVVGPGVVTGNTAVHDPTMCKDNSGKYFVFSTGTGIEIRTSTDRTAWTFAGRVWPNGA
PWTDKYTLTSNGAIWAPDCTYINGQFWLYYSASSFGSQNSAIFLAKSSTGAPGSWSHEGMVTSSSPSNNYNAIDP
NLLIDGGRWFLSLGSFWTGIKSMNINPSNGFLADTRVTALSQRTANSGAIEASVIFKFNNSYYLFTSWDNCCRGT
SSTYNIRVGRSNSPTGDFVDQNGVALTNGGGTLVLGSHDNIVGPGGQDIMLDGDGPILIYHYYTPSGSFLGINRL
DFSSGWPVVV*
Coding >Agabi119p4|102240
ATGCGCTCTCTTTTTGCGTTAGCTCTGCTCTCTTTTGCTTCCCTCGGATATGCCGTTGTAGGCCCAGGAGTCGTT
ACAGGAAACACGGCTGTCCACGACCCTACTATGTGTAAAGACAACTCTGGAAAATACTTTGTCTTCTCTACTGGG
ACGGGGATCGAGATCAGAACCTCTACTGATCGGACGGCATGGACTTTCGCTGGAAGAGTATGGCCCAATGGAGCA
CCTTGGACAGACAAATATACACTCACTTCCAATGGTGCGATATGGGCCCCGGATTGTACCTACATTAATGGACAG
TTCTGGCTTTATTACTCGGCTTCCAGCTTCGGCTCGCAGAATTCGGCTATCTTCCTTGCCAAATCTTCCACTGGT
GCTCCCGGCAGTTGGAGCCACGAAGGCATGGTGACTTCTTCATCACCTTCCAATAACTATAATGCCATTGATCCC
AATCTCTTGATCGACGGTGGTAGATGGTTCCTTTCCCTCGGTAGTTTCTGGACAGGTATCAAGTCTATGAATATA
AACCCATCCAATGGTTTCCTCGCCGACACCAGAGTCACTGCTCTTTCTCAACGTACGGCAAACAGTGGTGCCATC
GAAGCCAGCGTCATTTTCAAATTCAACAACTCCTACTATCTCTTCACAAGTTGGGATAACTGCTGCAGGGGCACT
TCTAGTACCTACAACATACGTGTCGGACGCTCTAACTCGCCTACTGGTGATTTTGTCGATCAAAATGGAGTAGCT
CTTACAAATGGAGGTGGTACACTTGTTCTCGGCTCGCATGACAACATCGTCGGTCCCGGTGGCCAAGACATCATG
CTCGATGGCGACGGTCCGATTCTGATCTACCATTATTATACACCTTCTGGTAGCTTCCTCGGAATCAACAGGCTC
GATTTCTCCAGCGGCTGGCCCGTCGTTGTCTAA
Transcript >Agabi119p4|102240
ATGCGCTCTCTTTTTGCGTTAGCTCTGCTCTCTTTTGCTTCCCTCGGATATGCCGTTGTAGGCCCAGGAGTCGTT
ACAGGAAACACGGCTGTCCACGACCCTACTATGTGTAAAGACAACTCTGGAAAATACTTTGTCTTCTCTACTGGG
ACGGGGATCGAGATCAGAACCTCTACTGATCGGACGGCATGGACTTTCGCTGGAAGAGTATGGCCCAATGGAGCA
CCTTGGACAGACAAATATACACTCACTTCCAATGGTGCGATATGGGCCCCGGATTGTACCTACATTAATGGACAG
TTCTGGCTTTATTACTCGGCTTCCAGCTTCGGCTCGCAGAATTCGGCTATCTTCCTTGCCAAATCTTCCACTGGT
GCTCCCGGCAGTTGGAGCCACGAAGGCATGGTGACTTCTTCATCACCTTCCAATAACTATAATGCCATTGATCCC
AATCTCTTGATCGACGGTGGTAGATGGTTCCTTTCCCTCGGTAGTTTCTGGACAGGTATCAAGTCTATGAATATA
AACCCATCCAATGGTTTCCTCGCCGACACCAGAGTCACTGCTCTTTCTCAACGTACGGCAAACAGTGGTGCCATC
GAAGCCAGCGTCATTTTCAAATTCAACAACTCCTACTATCTCTTCACAAGTTGGGATAACTGCTGCAGGGGCACT
TCTAGTACCTACAACATACGTGTCGGACGCTCTAACTCGCCTACTGGTGATTTTGTCGATCAAAATGGAGTAGCT
CTTACAAATGGAGGTGGTACACTTGTTCTCGGCTCGCATGACAACATCGTCGGTCCCGGTGGCCAAGACATCATG
CTCGATGGCGACGGTCCGATTCTGATCTACCATTATTATACACCTTCTGGTAGCTTCCTCGGAATCAACAGGCTC
GATTTCTCCAGCGGCTGGCCCGTCGTTGTCTAA
Gene >Agabi119p4|102240
ATGCGCTCTCTTTTTGCGTTAGCTCTGCTCTCTTTTGCTTCCCTCGGATATGCCGTTGTAGGCCCAGGAGTCGTT
ACAGGAAACACGGCTGTCCACGACCCTACTATGTGTAAAGACAACTCTGGAAAATACTTTGTCTTCTGTGCGTCG
GTTTGGAAGGATCCTGCTTTTGAAGGAGTAATCTCATTAATTAATTTCAAGCTACTGGGACGGGGATCGAGATCA
GAACCTCTACTGATCGGACGGCATGGACTTTCGCTGGAAGAGTATGGCCCAATGGAGCACCTTGGACAGACAAAT
ATACACTCACTTCCAATGGGTATGTTGGCAGAGGTAGTAATTACTTCTTTGACGCACCTCGAAATTTCTAGTGCG
ATATGGGCCCCGGATTGTACCTACATTAATGGACAGTTCTGGGTAGGTAGACCCAGATGCATCTTTGGAAATACC
AGCTTAATCATTGCCCAGCTTTATTACTCGGCTTCCAGCTTCGGCTCGCAGAATGTAAGCTCGTTCTTCTCTCAG
AATCAAATCTTTCTATATTGTACCCTCGACAGTCGGCTATCTTCCTTGCCAAATCTTCCACTGGTGCTCCCGGTG
AGTCTAGGGTCCTGGCATGGGCGAAGTGGAGCTCTCATCCTTTTCGTTTCAGGCAGTTGGAGCCACGAAGGCATG
GTGACTTCTTCATCACCTTCCAATAACTATAATGTAAGTGTTCAATTGATAAAGAAACATCTTCTGACAATTCTT
AGGCCATTGATCCCAAGTACGTGCGGGTTCTATCAAATACAACTAATACTAAGTCACGATTTTGAATCCCATGAA
ATAGTCTCTTGATCGGTGCGTCTTAGCAATTGAACCTTGAATCCAGGCTGTTTTTAAAACTGGTTGCTTCATAGA
CGGTGGTAGATGGTTCCTTTCCCTCGGTAGTTTCTGGACAGGTATCAAGTCTATGAAGTTAGTCTCCTCTTTTCT
ATCTTCTTCACAACATCAAGCCTCATTCCTCTTTCAAGTATAAACCCATCCAATGGTTTCCTCGCCGACACCAGA
GTCACTGCTCTTTCTCAACGTACGGCAAACAGTGGTGCCATCGAAGCCAGCGTCATTTTCAAATTCAACAACTCC
TACTATCTCTTCACAAGTTGGGATAACTGCTGCAGGGGCACTTCTAGTACCTACAACATACGTGTCGGACGCTCT
AACTCGTAAGTGTGAAACTTTGCCCCCCCTCCCCCCTTCTTATTGGATATGACTGAACATGAGGGTAGGCCTACT
GGTGATTTTGTCGATCAAAATGGAGTAGCTCTTACAAATGGAGGTGGTACACTTGTTCTCGGCTCGCATGACAAC
GTGAGTTTTCAATCAAAACCCTCCAGAATGCTCGAATGACATATACACTGCAATAGATCGTCGGTCCCGGTGGCC
AAGACATCATGCTCGATGGCGACGGTCCGATTCTGATCTACCGTAAGTACTCCATCCCCCATATATTTCAACTAC
AACTAAGCAAATACATTACATTATCACACAGATTATTATACACCTTCTGGTAGCTTCGTAAGCGATTTACTCTCC
CTTTTCTCGAACTGATCGGTGACTTATCAAACAAATAGCTCGGAATCAACAGGCTCGATTTCTCCAGCGGCTGGC
CCGTCGTTGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail