Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|102210
Gene name
Locationscaffold_07:1182967..1184308
Strand-
Gene length (bp)1341
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family 2.9E-37 1 219
PF15617 C-C_Bond_Lyase C-C_Bond_Lyase of the TIM-Barrel fold 6.0E-09 192 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N0X4|CLYBL_HUMAN Citrate lyase subunit beta-like protein, mitochondrial OS=Homo sapiens GN=CLYBL PE=1 SV=2 3 279 4.0E-44
sp|Q5I0K3|CLYBL_RAT Citrate lyase subunit beta-like protein, mitochondrial OS=Rattus norvegicus GN=Clybl PE=2 SV=2 3 279 5.0E-43
sp|Q8R4N0|CLYBL_MOUSE Citrate lyase subunit beta-like protein, mitochondrial OS=Mus musculus GN=Clybl PE=1 SV=2 3 279 2.0E-42
sp|Q9RUZ0|CITEL_DEIRA Citrate lyase subunit beta-like protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_1240 PE=1 SV=1 1 277 1.0E-31
sp|O53078|CITE_LEUMC Citrate lyase subunit beta OS=Leuconostoc mesenteroides subsp. cremoris GN=citE PE=3 SV=1 10 284 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N0X4|CLYBL_HUMAN Citrate lyase subunit beta-like protein, mitochondrial OS=Homo sapiens GN=CLYBL PE=1 SV=2 3 279 4.0E-44
sp|Q5I0K3|CLYBL_RAT Citrate lyase subunit beta-like protein, mitochondrial OS=Rattus norvegicus GN=Clybl PE=2 SV=2 3 279 5.0E-43
sp|Q8R4N0|CLYBL_MOUSE Citrate lyase subunit beta-like protein, mitochondrial OS=Mus musculus GN=Clybl PE=1 SV=2 3 279 2.0E-42
sp|Q9RUZ0|CITEL_DEIRA Citrate lyase subunit beta-like protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_1240 PE=1 SV=1 1 277 1.0E-31
sp|O53078|CITE_LEUMC Citrate lyase subunit beta OS=Leuconostoc mesenteroides subsp. cremoris GN=citE PE=3 SV=1 10 284 1.0E-30
sp|P17725|CITE_KLEPN Citrate lyase subunit beta OS=Klebsiella pneumoniae GN=citE PE=1 SV=2 1 284 5.0E-27
sp|P44460|CITE_HAEIN Citrate lyase subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=citE PE=3 SV=1 1 282 6.0E-25
sp|P0A9I1|CITE_ECOLI Citrate lyase subunit beta OS=Escherichia coli (strain K12) GN=citE PE=2 SV=1 1 284 5.0E-24
sp|P0A9I2|CITE_ECOL6 Citrate lyase subunit beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=citE PE=3 SV=1 1 284 5.0E-24
sp|A4WNM9|MCTE_RHOS5 (3S)-malyl-CoA thioesterase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mcl2 PE=3 SV=1 2 285 2.0E-23
sp|D3JV05|MCTE_RHOS4 (3S)-malyl-CoA thioesterase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mcl2 PE=1 SV=1 2 285 2.0E-22
sp|B9KNB6|MCTE_RHOSK (3S)-malyl-CoA thioesterase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=mcl2 PE=3 SV=1 2 285 5.0E-22
sp|A3PN16|MCTE_RHOS1 (3S)-malyl-CoA thioesterase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mcl2 PE=3 SV=1 2 285 6.0E-22
sp|A4WVF5|MCAL_RHOS5 L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mcl1 PE=3 SV=2 1 280 1.0E-21
sp|B9KLE8|MCAL_RHOSK L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=mcl1 PE=3 SV=2 1 280 1.0E-21
sp|Q3J5L6|MCAL_RHOS4 L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mcl1 PE=1 SV=1 1 280 1.0E-21
sp|A3PGR7|MCAL_RHOS1 L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mcl1 PE=3 SV=1 1 280 1.0E-21
sp|D5AR83|MCAL_RHOCB L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=mcl1 PE=3 SV=1 1 282 1.0E-20
sp|B6E2X2|MCAL_RHOCA L-malyl-CoA/beta-methylmalyl-CoA lyase OS=Rhodobacter capsulatus GN=mcl1 PE=1 SV=1 1 282 1.0E-20
sp|P9WPE1|CITEL_MYCTU Citrate lyase subunit beta-like protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=citE PE=1 SV=1 11 282 3.0E-18
sp|P9WPE0|CITEL_MYCTO Citrate lyase subunit beta-like protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=citE PE=3 SV=1 11 282 3.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|102210
MLEKTKASPSDVFVYDLEDSVSPVPADKANARERLREFLRKDPISNHDRVGVRVNDISTPYFEEDIKAIVSLPNV
TNLILPKIHSAQDLDRVSDIVFKLYRDTEREAVLNIIPSIESARAMVNIDKIAGWSSKGGTQMGGVLSALLFAAE
DYCADTSIVRTPSRRELLYTRSQIVITAKAFGLDAIDMVCVQYKDLKVLEDECIDGRQLGFTGKQAIHPAQVETI
QSTYVPSSKEILRAAKILHQMKLAHEAEKGAIGLEGEMIDAPMIKQAEKIVTIAKAAGLAIPDVSSST*
Coding >Agabi119p4|102210
ATGCTTGAAAAAACGAAAGCATCACCATCTGATGTGTTTGTGTATGACTTAGAGGACAGTGTGTCTCCTGTCCCT
GCGGACAAAGCGAATGCCAGGGAACGGTTGAGGGAGTTCTTACGCAAAGATCCTATTTCGAATCACGACCGGGTT
GGTGTACGTGTTAATGACATTAGTACACCATATTTTGAGGAAGACATCAAGGCTATCGTATCCCTCCCAAATGTA
ACAAATCTCATTCTTCCGAAGATTCATAGTGCCCAGGACTTGGATCGCGTTTCAGACATTGTCTTTAAATTGTAC
AGGGATACAGAACGAGAAGCTGTTTTGAACATCATTCCAAGTATTGAAAGTGCTAGAGCAATGGTTAATATTGAC
AAGATAGCTGGCTGGAGTTCGAAAGGTGGAACTCAAATGGGCGGGGTTTTGAGTGCATTGTTGTTTGCTGCTGAG
GACTATTGTGCAGATACTTCGATTGTAAGAACGCCCTCAAGACGGGAACTCCTTTACACTCGATCTCAGATTGTT
ATTACGGCGAAAGCGTTTGGCCTAGATGCTATTGACATGGTTTGTGTGCAATATAAAGATTTGAAAGTCCTTGAA
GATGAGTGCATTGATGGGAGGCAACTTGGCTTCACTGGTAAACAAGCTATCCACCCTGCACAGGTTGAAACCATC
CAATCGACATACGTTCCTTCGTCCAAAGAAATTCTTCGTGCGGCGAAGATATTACACCAGATGAAGCTTGCACAT
GAAGCTGAGAAAGGAGCTATTGGTTTAGAAGGTGAAATGATTGATGCACCTATGATCAAGCAGGCAGAAAAGATC
GTCACTATTGCAAAGGCAGCTGGTTTGGCTATACCTGATGTATCATCTTCTACTTAA
Transcript >Agabi119p4|102210
ATGCTTGAAAAAACGAAAGCATCACCATCTGATGTGTTTGTGTATGACTTAGAGGACAGTGTGTCTCCTGTCCCT
GCGGACAAAGCGAATGCCAGGGAACGGTTGAGGGAGTTCTTACGCAAAGATCCTATTTCGAATCACGACCGGGTT
GGTGTACGTGTTAATGACATTAGTACACCATATTTTGAGGAAGACATCAAGGCTATCGTATCCCTCCCAAATGTA
ACAAATCTCATTCTTCCGAAGATTCATAGTGCCCAGGACTTGGATCGCGTTTCAGACATTGTCTTTAAATTGTAC
AGGGATACAGAACGAGAAGCTGTTTTGAACATCATTCCAAGTATTGAAAGTGCTAGAGCAATGGTTAATATTGAC
AAGATAGCTGGCTGGAGTTCGAAAGGTGGAACTCAAATGGGCGGGGTTTTGAGTGCATTGTTGTTTGCTGCTGAG
GACTATTGTGCAGATACTTCGATTGTAAGAACGCCCTCAAGACGGGAACTCCTTTACACTCGATCTCAGATTGTT
ATTACGGCGAAAGCGTTTGGCCTAGATGCTATTGACATGGTTTGTGTGCAATATAAAGATTTGAAAGTCCTTGAA
GATGAGTGCATTGATGGGAGGCAACTTGGCTTCACTGGTAAACAAGCTATCCACCCTGCACAGGTTGAAACCATC
CAATCGACATACGTTCCTTCGTCCAAAGAAATTCTTCGTGCGGCGAAGATATTACACCAGATGAAGCTTGCACAT
GAAGCTGAGAAAGGAGCTATTGGTTTAGAAGGTGAAATGATTGATGCACCTATGATCAAGCAGGCAGAAAAGATC
GTCACTATTGCAAAGGCAGCTGGTTTGGCTATACCTGATGTATCATCTTCTACTTAA
Gene >Agabi119p4|102210
ATGCTTGAAAAAACGAAAGCATCACCATCTGATGTGTTTGTGTATGACTTAGAGGACAGTGTGTCTCCTGTCCCT
GCGGACAAAGCGAATGCCAGGGAACGGTTGAGGGAGTTCTTACGCGTCAGTCGCTTGTCCTGATCTTCTGCTTTG
ATTCCTAACGAGACTTGCTCCGGTGGCACCGCGGGTTATGTAGAAAGATCCTATTTCGAATCACGACCGGGTTGG
TGTACGTGTTAATGACATTAGTACACCATATTTTGAGGAAGACATCAAGGCTATCGTAAGTCCTCTCATTCTCAT
AGGAAAGTCACCACGAACCTCATATCTGGACTCAGGTATCCCTCCCAAATGTAACAAATCTCATTCTTCCGAAGA
TTCATAGTGCCCAGGACTTGGATCGCGTTTCAGACATTGTCTTTAAATTGTACAGGGATACAGAACGAGAAGCTG
TTTTGAACATCATTCCAAGTATTGAAAGTGCTAGAGCAATGGTTAATATTGACAAGATAGCTGGCTGGAGTTCGA
AAGGTGGAACTCAAATGGGCGGGGTTTTGAGTGCATTGTTGGTTCGTCTGAACCCATCACTTCTCTTCATTGTCA
ACAAATAATAACCCATGGGGAGTATAGTTTGCTGCTGAGGACTGTGAGGAGACACTCTCGGAATTCATGGGATAC
TAAAACGTGAAGTGTCATAGATTGTGCAGATACTTCGATTGTAAGAACGCCCTCAAGACGGGAACTCCTTTACAC
TCGATCTCAGATTGTTATTACGGCGAAAGCGTTTGGCCTAGATGCTATTGACATGGTACGTCCTGACTCTTCTGC
CTTGGGGAACTGCAATGCTCATGGGGAGATGGCAGGTTTGTGTGCAATATAAAGATTTGAAAGTCCTTGAAGATG
AGTGCATTGATGGGAGGCAACTTGGCTTCACTGGTAAAGTTCGTTATATTCCTTTCTTGCTTTGATGCCAATTTA
ACGCATATCGTGGATATTATAGCAAGCTATCCACCCTGCACAGGTTGAAACCATCCAATCGACATACGTTCCTTC
GTCCAAAGGTAAATTTGTCTTGGATTCTCGATTGACAGGTTATATTGAATCTCTATGTGCAGAAATTCTTCGTGC
GGCGAAGATATTACACCAGATGAAGCTTGCACATGAAGCTGAGAAAGGAGCTATTGGTTTAGAAGGTGAAATGAT
TGATGCACCTATGATCAAGCAGGTAAGTTGTCTGCAGTTGAACGAAACGACCACCCATATATCTTTCCTCAGGCA
GAAAAGATCGTCACTATTGCAAAGGCAGCTGGTTTGGCTATACCTGATGTATCATCTTCTACTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail