Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|101920
Gene name
Locationscaffold_07:1108387..1110094
Strand+
Gene length (bp)1707
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04577 Glyco_transf_61 Glycosyltransferase 61 4.5E-12 165 389

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|101920
MHQLFPTRREFALVLLFLLLLVLLNRGPGTSYPPNVPSSSRRHTLQAEQPALPQTQLSWKNNPVPQTKLVAHVPG
WTIFDRLYVFKGVVYIVSDDEGSLPHVQFILSRGIQIENGQEAELGRLPTDEDIRIISTEEARRLFGVGASILDG
VTLFVNDPHQFITHYYHWSAELWFGFWRTYSTLDTTITSDGNTTLPFTRRIMFNHLDAHHWRDYAHMNEWVVRSS
FPSATMEFMDDWRDRAELGKPFVFDRIVIADRSAAMRSYNFQRYQRTASAAFALPGSVNWWMPIRNNVIKFARLD
SDTGGGTTGAPVITYISRQQWGRRMLIPEHHEKLVHELHKLRDVYGYEVNIVEAENMSRVEQIRLAARTTVMMGV
HGNGLTSLVWMKPNPRSTVMEFFYPQGFAHDYEFTTRALGMTHYGFWGNQSFTSPDLPLPQYVEGFQGNSIPIDA
EAVARLCVERLSLNFEVDD*
Coding >Agabi119p4|101920
ATGCACCAGCTGTTTCCCACGCGGCGCGAGTTCGCTCTTGTGTTGCTCTTTCTCCTCCTCCTCGTCTTACTCAAC
CGCGGCCCCGGCACTTCATATCCTCCCAACGTTCCTTCTTCCAGCCGACGACATACACTCCAGGCAGAACAACCT
GCCCTACCACAAACTCAGCTCTCATGGAAAAATAATCCGGTGCCTCAGACGAAGCTTGTGGCCCATGTGCCAGGC
TGGACAATTTTTGACAGACTATATGTCTTCAAAGGCGTCGTATATATCGTATCGGACGATGAGGGGTCGCTACCG
CACGTCCAGTTTATCCTCTCAAGAGGCATTCAAATTGAAAATGGACAAGAGGCTGAGCTCGGCAGACTACCAACG
GACGAAGATATCCGTATTATCAGCACAGAAGAGGCAAGGCGGTTGTTTGGAGTAGGTGCTTCCATTCTTGATGGT
GTCACTCTTTTCGTCAATGACCCTCATCAATTCATCACTCACTATTACCACTGGTCGGCCGAACTCTGGTTTGGC
TTTTGGCGCACCTATTCTACCCTCGACACTACGATCACTTCAGACGGAAACACTACTCTGCCATTTACACGGCGC
ATCATGTTTAACCACTTGGATGCGCACCACTGGCGTGACTATGCCCACATGAATGAATGGGTAGTCCGCTCCTCT
TTTCCCTCTGCTACGATGGAATTCATGGATGACTGGCGCGATAGGGCCGAACTCGGCAAACCATTTGTTTTTGAT
CGCATCGTCATTGCCGATCGCTCAGCTGCCATGCGATCGTACAATTTCCAACGCTATCAAAGGACTGCTTCTGCT
GCCTTTGCGTTGCCCGGGAGTGTTAACTGGTGGATGCCAATCCGGAACAACGTCATCAAGTTTGCAAGGTTAGAC
TCCGACACAGGAGGTGGAACAACAGGTGCACCCGTCATCACCTATATCTCTAGGCAACAATGGGGAAGACGCATG
TTGATTCCAGAACACCACGAGAAACTGGTCCACGAACTTCATAAACTGCGAGACGTATATGGCTATGAAGTAAAC
ATTGTAGAGGCCGAGAATATGTCACGCGTTGAGCAAATCCGACTCGCTGCTCGGACTACTGTAATGATGGGAGTC
CATGGAAATGGTCTGACTTCTCTCGTCTGGATGAAACCAAATCCTCGTTCCACCGTTATGGAATTCTTTTACCCC
CAAGGCTTCGCACATGACTATGAATTCACTACTCGAGCACTTGGAATGACACATTATGGCTTCTGGGGCAATCAG
TCTTTTACAAGCCCAGACCTTCCACTTCCACAATATGTTGAAGGGTTCCAAGGAAACTCAATTCCTATAGATGCA
GAGGCAGTTGCTCGTTTATGCGTTGAACGCTTATCTCTCAATTTTGAAGTGGATGATTAA
Transcript >Agabi119p4|101920
ATGCACCAGCTGTTTCCCACGCGGCGCGAGTTCGCTCTTGTGTTGCTCTTTCTCCTCCTCCTCGTCTTACTCAAC
CGCGGCCCCGGCACTTCATATCCTCCCAACGTTCCTTCTTCCAGCCGACGACATACACTCCAGGCAGAACAACCT
GCCCTACCACAAACTCAGCTCTCATGGAAAAATAATCCGGTGCCTCAGACGAAGCTTGTGGCCCATGTGCCAGGC
TGGACAATTTTTGACAGACTATATGTCTTCAAAGGCGTCGTATATATCGTATCGGACGATGAGGGGTCGCTACCG
CACGTCCAGTTTATCCTCTCAAGAGGCATTCAAATTGAAAATGGACAAGAGGCTGAGCTCGGCAGACTACCAACG
GACGAAGATATCCGTATTATCAGCACAGAAGAGGCAAGGCGGTTGTTTGGAGTAGGTGCTTCCATTCTTGATGGT
GTCACTCTTTTCGTCAATGACCCTCATCAATTCATCACTCACTATTACCACTGGTCGGCCGAACTCTGGTTTGGC
TTTTGGCGCACCTATTCTACCCTCGACACTACGATCACTTCAGACGGAAACACTACTCTGCCATTTACACGGCGC
ATCATGTTTAACCACTTGGATGCGCACCACTGGCGTGACTATGCCCACATGAATGAATGGGTAGTCCGCTCCTCT
TTTCCCTCTGCTACGATGGAATTCATGGATGACTGGCGCGATAGGGCCGAACTCGGCAAACCATTTGTTTTTGAT
CGCATCGTCATTGCCGATCGCTCAGCTGCCATGCGATCGTACAATTTCCAACGCTATCAAAGGACTGCTTCTGCT
GCCTTTGCGTTGCCCGGGAGTGTTAACTGGTGGATGCCAATCCGGAACAACGTCATCAAGTTTGCAAGGTTAGAC
TCCGACACAGGAGGTGGAACAACAGGTGCACCCGTCATCACCTATATCTCTAGGCAACAATGGGGAAGACGCATG
TTGATTCCAGAACACCACGAGAAACTGGTCCACGAACTTCATAAACTGCGAGACGTATATGGCTATGAAGTAAAC
ATTGTAGAGGCCGAGAATATGTCACGCGTTGAGCAAATCCGACTCGCTGCTCGGACTACTGTAATGATGGGAGTC
CATGGAAATGGTCTGACTTCTCTCGTCTGGATGAAACCAAATCCTCGTTCCACCGTTATGGAATTCTTTTACCCC
CAAGGCTTCGCACATGACTATGAATTCACTACTCGAGCACTTGGAATGACACATTATGGCTTCTGGGGCAATCAG
TCTTTTACAAGCCCAGACCTTCCACTTCCACAATATGTTGAAGGGTTCCAAGGAAACTCAATTCCTATAGATGCA
GAGGCAGTTGCTCGTTTATGCGTTGAACGCTTATCTCTCAATTTTGAAGTGGATGATTAA
Gene >Agabi119p4|101920
ATGCACCAGCTGTTTCCCACGCGGCGCGAGTTCGCTCTTGTGTTGCTCTTTCTCCTCCTCCTCGTCTTACTCAAC
CGCGGCCCCGGCACTTCATATCCTCCCAACGTTCCTTCTTCCAGCCGACGACATACACTCCAGGCAGAACAACCT
GCCCTACCACAAACTCAGCTCTCATGGAAAAATAATCCGGTGCCTCAGACGAAGCTTGTGGCCCATGTGCCAGGT
ATGTCCCAGCTTCTCGTACTCTCGCGTGCCACTCTTCATTCGCACCGTGTTCAGGCTGGACAATTTTTGACAGAC
TATATGTCTTCAAAGGCGTCGTATATATCGTATCGGACGATGAGGGGTCGCTACCGCACGTCCAGTTTATCCTCT
CAAGAGGCATTCAAATTGAAAATGGACAAGAGGCTGAGCTCGGCAGACTACCAACGGACGAAGATATCCGTATTA
TCAGCACAGAAGAGGCAAGGCGGTTGTTTGGAGTAGGTGCTTCCATTCTTGATGGTGTCACTGTATGTCGGTCGC
TTTCTAGCACCTTTCCTCCTTGACAATTTATCACTAGCTTTTCGTCAATGACCCTCATCAATTGTATGGTTCCTC
CTCTGCAACGTTCCCATGATATCTAAACTCTTTCCTTCGCAGCATCACTCACTATTACCACTGGTCGGCCGAACT
CTGGTTTGGCTTTTGGCGCACCTATTCTACCCTCGACACTACGATCACTTCAGACGGAAACACTACTCTGCCATT
TACACGGCGCATCATGTTTAACCACTTGGATGCGCACCACTGGCGTGACTATGCCCACATGAATGAATGGGTAGT
CCGCTCCTCTTTTCCCTCTGCTACGATGGAATTCATGGATGACTGGCGCGATAGGGCCGAACTCGGCAAACCATT
TGTTTTTGATCGCATCGTCATTGCCGATCGCTCAGCTGCCATGCGATCGTACAATTTCCAACGCTATCAAAGGAC
TGCTTCTGCTGCCTTTGCGTTGCCCGGGAGTGTTAACTGGTGGATGCCAATCCGGAACAACGTCATCAAGTTTGC
AAGGTTAGACTCCGACACAGGAGGTGGAACAACAGGTGCACCCGTCATCACCTATATCTCTAGGCAACAATGGGG
AAGACGCATGTTGATTCCAGAACACCACGAGAAACTGGTCCACGAACTTCATAAACTGCGAGACGTATATGGCTA
TGAAGTAAACATTGTAGAGGCCGAGAATATGTCACGCGTTGAGCAAATCCGACTCGCTGCTCGGACTACTGTACG
TCTACTGCCGCTTCTTTTCTCTTCGGAGAAGGTTTTTCGCTGATCTGACGCCACATCTATCTAATTAACTAGGTA
ATGATGGGAGTCCATGGAAATGGTCTGACTTCTCTCGTCTGGATGAAACCAAATCCTCGTTCCACCGTTATGGAA
TTCTTTTACCCCCAAGGCTTCGCACATGACTATGAATTCACTACTCGAGCACTTGGAATGACACATTATGGCTTC
TGGGGCAATCAGTACGTTTTCCGAACGACTATCAACATTATCCCGTTTTATATCTTTCTCTTGATTTCCAGGTCT
TTTACAAGCCCAGACCTTCCACTTCCACAATATGTTGAAGGGTTCCAAGGAAACTCAATTCCTATAGATGCAGAG
GCAGTTGCTCGTTTATGCGTTGAACGCTTATCTCTCAATTTTGAAGTGGATGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail