Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|101630
Gene name
Locationscaffold_07:1037182..1038797
Strand-
Gene length (bp)1615
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 5.6E-07 251 276
PF18044 zf-CCCH_4 CCCH-type zinc finger 1.6E-06 254 275

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|101630
MSTKTKKYPPLKKRHTKPCKYFQFGLCTNTAEECNFAHVSVMPSLTFPPSMQGLHVLGRGHDINVIPPPSHPSSY
TGACSYVNPYPTHPPYYYHPWAPANLYPGHPGSFTVGSPEIPTNVQSPDVKSRSYSTSMSVASPQLDAPCIDFDS
TVGALGLTRNEENEDENDCVRTGNPNFVEHQHIQHQSQVRVEDRPLFDRPEGYAMRESPVWDSSGTPHQTSWDGA
WGSRNQATRGPRRSIFRTVSRKTTKYKTKPCKFYTVENGCPNGDRCTFIHSTDVPPVPPMTLSHSQNTRPRRKSD
SYLQTPCIAAFKGSGEPDIERPRVDTSETEDNKEKKKDFFPITWRVIGGGVLIGGKRAENPGEKGLSTDRGEEVE
EVSDDDKNDKVIEKELPKLCAKDLKRRSRSMSPSIP*
Coding >Agabi119p4|101630
ATGTCAACCAAAACGAAGAAGTATCCTCCGCTCAAGAAGCGCCACACGAAACCTTGCAAGTATTTTCAATTTGGA
CTATGTACAAACACTGCCGAAGAGTGTAACTTCGCGCATGTGTCAGTTATGCCAAGTCTGACCTTTCCCCCTTCG
ATGCAAGGGCTACATGTGTTAGGGCGAGGCCATGATATCAATGTTATACCCCCGCCATCTCACCCGTCATCATAC
ACTGGAGCTTGCAGTTATGTTAATCCTTATCCCACCCACCCACCCTATTACTACCATCCCTGGGCACCAGCAAAC
CTTTACCCAGGACATCCAGGCTCTTTCACTGTTGGGAGCCCTGAAATTCCTACCAATGTTCAGTCTCCGGACGTT
AAATCGCGATCCTATTCAACCTCAATGTCGGTTGCTAGTCCACAGCTAGACGCGCCCTGCATTGATTTTGATTCT
ACGGTCGGAGCCCTCGGCTTGACGAGAAACGAAGAGAACGAGGATGAAAATGATTGTGTTAGGACGGGAAATCCA
AATTTTGTAGAACATCAACATATTCAACATCAATCGCAGGTTCGTGTAGAAGATCGACCGTTATTCGATAGACCC
GAAGGATATGCAATGCGTGAATCCCCTGTTTGGGACTCTAGCGGAACGCCACACCAAACCTCGTGGGATGGAGCA
TGGGGTAGTAGAAATCAGGCAACAAGGGGACCCCGTCGCAGTATATTTCGGACTGTTTCACGGAAGACCACTAAA
TACAAGACCAAACCCTGTAAATTTTACACCGTTGAGAATGGGTGTCCCAATGGTGATCGCTGTACTTTCATCCAT
AGCACAGATGTTCCTCCTGTGCCTCCCATGACTCTGAGTCATTCGCAAAACACAAGGCCGCGTCGGAAGAGTGAC
AGCTACTTACAGACACCCTGCATCGCTGCTTTCAAGGGCAGTGGGGAACCGGATATTGAGAGACCACGAGTTGAC
ACTTCGGAGACTGAAGACAATAAGGAGAAAAAGAAGGACTTCTTCCCCATCACTTGGCGTGTGATTGGAGGCGGC
GTACTGATTGGTGGTAAACGCGCGGAGAACCCGGGGGAGAAAGGCTTGAGCACCGATCGAGGAGAGGAGGTGGAA
GAAGTCAGCGATGACGATAAAAATGACAAAGTCATTGAGAAAGAATTGCCGAAGCTCTGTGCAAAGGACCTCAAG
CGAAGATCGAGGTCAATGAGCCCATCTATTCCATAA
Transcript >Agabi119p4|101630
ATGTCAACCAAAACGAAGAAGTATCCTCCGCTCAAGAAGCGCCACACGAAACCTTGCAAGTATTTTCAATTTGGA
CTATGTACAAACACTGCCGAAGAGTGTAACTTCGCGCATGTGTCAGTTATGCCAAGTCTGACCTTTCCCCCTTCG
ATGCAAGGGCTACATGTGTTAGGGCGAGGCCATGATATCAATGTTATACCCCCGCCATCTCACCCGTCATCATAC
ACTGGAGCTTGCAGTTATGTTAATCCTTATCCCACCCACCCACCCTATTACTACCATCCCTGGGCACCAGCAAAC
CTTTACCCAGGACATCCAGGCTCTTTCACTGTTGGGAGCCCTGAAATTCCTACCAATGTTCAGTCTCCGGACGTT
AAATCGCGATCCTATTCAACCTCAATGTCGGTTGCTAGTCCACAGCTAGACGCGCCCTGCATTGATTTTGATTCT
ACGGTCGGAGCCCTCGGCTTGACGAGAAACGAAGAGAACGAGGATGAAAATGATTGTGTTAGGACGGGAAATCCA
AATTTTGTAGAACATCAACATATTCAACATCAATCGCAGGTTCGTGTAGAAGATCGACCGTTATTCGATAGACCC
GAAGGATATGCAATGCGTGAATCCCCTGTTTGGGACTCTAGCGGAACGCCACACCAAACCTCGTGGGATGGAGCA
TGGGGTAGTAGAAATCAGGCAACAAGGGGACCCCGTCGCAGTATATTTCGGACTGTTTCACGGAAGACCACTAAA
TACAAGACCAAACCCTGTAAATTTTACACCGTTGAGAATGGGTGTCCCAATGGTGATCGCTGTACTTTCATCCAT
AGCACAGATGTTCCTCCTGTGCCTCCCATGACTCTGAGTCATTCGCAAAACACAAGGCCGCGTCGGAAGAGTGAC
AGCTACTTACAGACACCCTGCATCGCTGCTTTCAAGGGCAGTGGGGAACCGGATATTGAGAGACCACGAGTTGAC
ACTTCGGAGACTGAAGACAATAAGGAGAAAAAGAAGGACTTCTTCCCCATCACTTGGCGTGTGATTGGAGGCGGC
GTACTGATTGGTGGTAAACGCGCGGAGAACCCGGGGGAGAAAGGCTTGAGCACCGATCGAGGAGAGGAGGTGGAA
GAAGTCAGCGATGACGATAAAAATGACAAAGTCATTGAGAAAGAATTGCCGAAGCTCTGTGCAAAGGACCTCAAG
CGAAGATCGAGGTCAATGAGCCCATCTATTCCATAA
Gene >Agabi119p4|101630
ATGTCAACCAAAACGAAGAAGTATCCTCCGCTCAAGAAGCGCCACAGTAAGTACTTGCATATCCAACTTTCCATC
TTCTTTTCAACTTGTTTTTTGCGTTCGGTACACTTCCGACATATATGTTCTATAGTTTGCTGACAAATTACATAG
CGAAACCTTGCAAGTATTTTCAATTTGGACTATGTACAAACACTGCCGAAGAGTGTAACTTCGCGCATGTGTCAG
TTATGCCAAGTCTGACCTTTCCCCCTTCGATGCAAGGGCTACATGTGTTAGGGCGAGGCCATGGTGAGTGTTCCC
GTTGAAGCACAGCGTATTATTGATCATGTATATGTTGTCTTGTCAGATATCAATGTTATACCCCCGCCATCTCAC
CGTAGGCCTCGATGTTGTCATTCAGTTTCATCGATATACTAATAATGGTATAGCGTCATCATACACTGGAGCTTG
CAGTTATGTTAATCCTTATCCCACCCACCCACCCTATTACTACCATCCCTGGGCACCAGCAAACCTTTACCCAGG
ACATCCAGGCTCTTTCACTGTTGGGAGCCCTGAAATTCCTACCAATGTTCAGTCTCCGGACGTTAAATCGCGATC
CTATTCAACCTCAATGTCGGTTGCTAGTCCACAGCTAGACGCGCCCTGCATTGATTTTGATTCTACGGTCGGAGC
CCTCGGCTTGACGAGAAACGAAGAGAACGAGGATGAAAATGATTGTGTTAGGACGGGAAATCCAAATGTAATTCA
AGTGAATCACCACGACGACGACGTCTTCACTGAGGACCCGCAGTTTGTAGAACATCAACATATTCAACATCAATC
GCAGGTTCGTGTAGAAGATCGACCGTTATTCGATAGACCCGAAGGATATGCAATGCGTGAATCCCCTGTTTGGGA
CTCTAGCGGAACGCCACACCAAACCTCGTGGGATGGAGCATGGGGTAGTAGAAATCAGGCAACAAGGGGACCCCG
TCGCAGTATATTTCGGACTGTTTCACGGAAGACCACTAAATACAAGAGTACGTGCGCAATATCACTTGACCGGTT
TTCTATTAGCTGACTTGACGGTAGCCAAACCCTGTAAATTTTACACCGTTGAGAATGGGTGTCCCAATGGTGATC
GCTGTACTTTGTGAGTCACCACTCTTGCTTTTTGCGTGGTCGCCGACCGTATACTTATGATGTTTATTTTAGCAT
CCATAGCACAGATGTTCCTCCTGTGCCTCCCATGACTCTGAGTCATTCGCAAAACACAAGGCCGCGTCGGAAGAG
TGACAGCTACTTACAGACACCCTGCATCGCTGCTTTCAAGGGCAGTGGGGAACCGGATATTGAGAGACCACGAGT
TGACACTTCGGAGACTGAAGACAATAAGGAGAAAAAGAAGGACTTCTTCCCCATCACTTGGCGTGTGATTGGAGG
CGGCGTACTGATTGGTGGTAAACGCGCGGAGAACCCGGGGGAGAAAGGCTTGAGCACCGATCGAGGAGAGGAGGT
GGAAGAAGTCAGCGATGACGATAAAAATGACAAAGTCATTGAGAAAGAATTGCCGAAGCTCTGTGCAAAGGACCT
CAAGCGAAGATCGAGGTCAATGAGCCCATCTATTCCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail