Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|101600
Gene name
Locationscaffold_07:1030511..1032766
Strand+
Gene length (bp)2255
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 9.8E-05 50 151
PF00026 Asp Eukaryotic aspartyl protease 1.9E-10 265 381

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 65 379 2.0E-13
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 51 379 3.0E-12
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 51 379 1.0E-11
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 48 378 5.0E-08
sp|D4AIC4|Y4018_ARTBC Probable aspartic-type endopeptidase ARB_04018 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04018 PE=3 SV=1 264 378 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|101600
MHHLPLSLLLLVFSVNAIIVPFKVRFSNGAPHTSLNRRTPTLISNIGNAQYVSNITLGGVTVPVLLDTGSSDLWS
AFPEDQPSITDLDESVSLSYAVGKVTGAVAVTTLSFDGFKVDNQAFLHVTDTSSFTSDLESQGYYGLIGLGPNSG
SAIAKKIKKDPRGDTTLSHIFEAHNETDNYISFLLTRKGDPSETSMQGQLTISEIVPGFENITSMPQMDVDKVNR
LLKADQHWQILTDKDTGIIGPDGQPLKVDSIVPGCPDGQLVAVIDSGFTFSQVPRDISDQIYGRVKGAYYDTNQE
FWMIPCQQSLNITFSFGGKSYPVHPLDTVDDNFNQVDSTGQKVCIGSFQPITSAFSMLGHYDMILGMSFLRNAYT
LLNFGNWIDSSSKTQEHPFIQLASITNVDQAHADFVKVRLGGIDTSGAAQYQLLPVDQMKRSPVSDEEKKKKYQE
MILSRWPYIFVGKSKKQGNSKLGGLFKRNRSENGGGNRALEETEVGFHSQKGDSENSKYHPLSDSNNLSMQDLHR
TNTDHSQRSFPPPPSYPNNPYPQGYHDGSTYSLQGNAADGYPQSTYVMNPHAMDSVASVHMQRQPQPHDFSGGYS
GNEFAAR*
Coding >Agabi119p4|101600
ATGCACCACCTCCCCCTATCTCTACTTCTTTTAGTTTTCTCTGTCAATGCCATCATTGTCCCCTTCAAAGTCCGC
TTTTCGAACGGTGCACCACACACTTCGCTGAACCGCAGAACACCCACATTAATATCGAACATCGGAAATGCTCAA
TATGTGAGCAACATTACCCTTGGAGGCGTAACAGTACCTGTTTTACTCGACACGGGCAGCTCCGATCTCTGGTCT
GCATTCCCCGAGGATCAACCTTCGATTACCGACCTCGACGAGAGTGTATCTCTTAGTTATGCCGTTGGCAAAGTA
ACAGGTGCCGTTGCTGTGACCACCCTTTCATTCGACGGTTTCAAAGTCGATAACCAGGCGTTCCTTCATGTCACA
GACACAAGTTCATTCACGTCCGATCTCGAGTCCCAAGGATACTATGGTCTCATCGGTCTCGGACCAAATTCTGGC
AGTGCCATCGCCAAGAAAATAAAAAAAGATCCACGAGGAGACACCACGCTCTCACACATTTTTGAGGCCCATAAC
GAAACCGACAACTACATCTCCTTTTTACTCACCCGCAAAGGTGACCCTAGTGAAACGAGCATGCAAGGCCAACTT
ACCATTTCCGAAATCGTGCCTGGCTTCGAGAATATCACCTCTATGCCCCAGATGGATGTCGACAAAGTAAACCGA
CTGCTGAAGGCTGATCAACATTGGCAAATTTTGACTGACAAAGACACTGGAATCATTGGTCCTGACGGTCAACCT
CTCAAAGTCGATTCTATCGTCCCGGGATGCCCCGACGGCCAGCTCGTCGCCGTCATTGACAGTGGATTTACATTT
TCTCAAGTTCCTCGTGACATCTCTGACCAGATCTATGGTCGTGTCAAAGGCGCTTACTATGATACCAATCAAGAG
TTCTGGATGATACCTTGTCAGCAGTCGCTCAACATCACTTTCAGTTTCGGTGGAAAATCTTATCCCGTACATCCC
CTCGATACCGTGGACGACAACTTTAACCAAGTTGATTCCACCGGTCAGAAAGTTTGTATCGGATCTTTCCAACCC
ATCACCTCCGCATTCTCCATGCTCGGCCACTATGACATGATTCTCGGCATGAGTTTCCTCCGTAATGCGTATACC
CTTCTCAACTTCGGCAATTGGATTGATAGCTCTTCCAAAACACAAGAACACCCGTTCATCCAACTCGCGTCAATC
ACCAACGTGGACCAGGCTCACGCCGACTTCGTCAAAGTCCGGCTTGGGGGAATTGATACTAGCGGTGCTGCGCAG
TACCAGCTGCTACCTGTCGACCAGATGAAACGCTCACCGGTGTCTGATGAGGAAAAAAAGAAAAAATACCAGGAG
ATGATTCTGAGTCGATGGCCGTATATCTTTGTCGGGAAGAGTAAAAAGCAAGGCAATAGTAAGTTGGGAGGTTTA
TTCAAGCGGAATCGCAGCGAGAATGGTGGTGGGAACAGAGCTCTGGAGGAGACGGAAGTTGGGTTCCACAGCCAG
AAGGGAGATAGTGAAAACTCAAAGTATCACCCCCTGTCCGATTCAAACAACCTCAGTATGCAGGACCTTCATCGA
ACGAACACAGATCACTCGCAGCGATCCTTCCCACCACCACCATCGTATCCGAATAACCCCTATCCGCAGGGTTAT
CACGATGGAAGCACATACTCGTTACAAGGGAACGCTGCCGATGGTTATCCTCAATCTACCTATGTTATGAACCCA
CATGCTATGGATAGTGTTGCGAGCGTACACATGCAAAGACAACCCCAACCCCACGATTTTAGCGGTGGATATAGT
GGTAATGAGTTTGCTGCTCGGTGA
Transcript >Agabi119p4|101600
ATGCACCACCTCCCCCTATCTCTACTTCTTTTAGTTTTCTCTGTCAATGCCATCATTGTCCCCTTCAAAGTCCGC
TTTTCGAACGGTGCACCACACACTTCGCTGAACCGCAGAACACCCACATTAATATCGAACATCGGAAATGCTCAA
TATGTGAGCAACATTACCCTTGGAGGCGTAACAGTACCTGTTTTACTCGACACGGGCAGCTCCGATCTCTGGTCT
GCATTCCCCGAGGATCAACCTTCGATTACCGACCTCGACGAGAGTGTATCTCTTAGTTATGCCGTTGGCAAAGTA
ACAGGTGCCGTTGCTGTGACCACCCTTTCATTCGACGGTTTCAAAGTCGATAACCAGGCGTTCCTTCATGTCACA
GACACAAGTTCATTCACGTCCGATCTCGAGTCCCAAGGATACTATGGTCTCATCGGTCTCGGACCAAATTCTGGC
AGTGCCATCGCCAAGAAAATAAAAAAAGATCCACGAGGAGACACCACGCTCTCACACATTTTTGAGGCCCATAAC
GAAACCGACAACTACATCTCCTTTTTACTCACCCGCAAAGGTGACCCTAGTGAAACGAGCATGCAAGGCCAACTT
ACCATTTCCGAAATCGTGCCTGGCTTCGAGAATATCACCTCTATGCCCCAGATGGATGTCGACAAAGTAAACCGA
CTGCTGAAGGCTGATCAACATTGGCAAATTTTGACTGACAAAGACACTGGAATCATTGGTCCTGACGGTCAACCT
CTCAAAGTCGATTCTATCGTCCCGGGATGCCCCGACGGCCAGCTCGTCGCCGTCATTGACAGTGGATTTACATTT
TCTCAAGTTCCTCGTGACATCTCTGACCAGATCTATGGTCGTGTCAAAGGCGCTTACTATGATACCAATCAAGAG
TTCTGGATGATACCTTGTCAGCAGTCGCTCAACATCACTTTCAGTTTCGGTGGAAAATCTTATCCCGTACATCCC
CTCGATACCGTGGACGACAACTTTAACCAAGTTGATTCCACCGGTCAGAAAGTTTGTATCGGATCTTTCCAACCC
ATCACCTCCGCATTCTCCATGCTCGGCCACTATGACATGATTCTCGGCATGAGTTTCCTCCGTAATGCGTATACC
CTTCTCAACTTCGGCAATTGGATTGATAGCTCTTCCAAAACACAAGAACACCCGTTCATCCAACTCGCGTCAATC
ACCAACGTGGACCAGGCTCACGCCGACTTCGTCAAAGTCCGGCTTGGGGGAATTGATACTAGCGGTGCTGCGCAG
TACCAGCTGCTACCTGTCGACCAGATGAAACGCTCACCGGTGTCTGATGAGGAAAAAAAGAAAAAATACCAGGAG
ATGATTCTGAGTCGATGGCCGTATATCTTTGTCGGGAAGAGTAAAAAGCAAGGCAATAGTAAGTTGGGAGGTTTA
TTCAAGCGGAATCGCAGCGAGAATGGTGGTGGGAACAGAGCTCTGGAGGAGACGGAAGTTGGGTTCCACAGCCAG
AAGGGAGATAGTGAAAACTCAAAGTATCACCCCCTGTCCGATTCAAACAACCTCAGTATGCAGGACCTTCATCGA
ACGAACACAGATCACTCGCAGCGATCCTTCCCACCACCACCATCGTATCCGAATAACCCCTATCCGCAGGGTTAT
CACGATGGAAGCACATACTCGTTACAAGGGAACGCTGCCGATGGTTATCCTCAATCTACCTATGTTATGAACCCA
CATGCTATGGATAGTGTTGCGAGCGTACACATGCAAAGACAACCCCAACCCCACGATTTTAGCGGTGGATATAGT
GGTAATGAGTTTGCTGCTCGGTGA
Gene >Agabi119p4|101600
ATGCACCACCTCCCCCTATCTCTACTTCTTTTAGTTTTCTCTGTCAATGCCATCATTGTCCCCTTCAAAGTCCGC
TTTTCGAACGGTGCACCACACACTTCGCTGAACCGCAGAACACCCACATTAATATCGAACATCGGAAATGCTCAA
TATGTGAGCAACATTACCCTTGGAGGCGTAACAGTACCTGTTTTACTCGACACGGGCAGGTATGAACAGAAATAT
TTCAGTGCGAGATGGATTTCTAATTTGTTGAACTTGATTCGCAGCTCCGATCTCTGGTCTGCATTCCCCGAGGAT
CAACCTTCGATTACCGACCTCGACGAGAGTGTATCTCTTAGTTATGCCGTTGGCAAAGTAACAGGTTGACAGTGT
TCTTGTGTGGCAAATTCGTGCGCTAACTGTCTTTTAGGTGCCGTTGCTGTGACCACCCTTTCATTCGACGGTTTC
AAAGTCGATAACCAGGCGTTCCGTGTGTTATTTCTTCTCCGTCCCGTCTTTAATACTCATATACTATTCTAGTTC
ATGTCACAGACACAAGTTCATTCACGTCCGATCTCGAGTCCCAAGGATACTATGGTCTCATCGGTCTCGGACCAA
ATTCTGGCAGTGCCATCGCCAAGAAAATAAAAAAAGATCCACGAGGAGACACCACGCTCTCACACATTTTTGAGG
CCCATAACGAAACCGACAACTACATCTCCTTTTTACTCACCCGCAAAGGTGACCCTAGTGAAACGAGCATGCAAG
GCCAACTTACCATTTCCGAAATCGTGCCTGGCTTCGAGAATATCACCTCTATGCCCCAGATGGATGTCGACAAAG
TAAACCGACTGCTGAAGGCTGGTGCGTTTTAAAAATGATCTTAAGGGCACGAGACCTATAAACTGATGTACTGTG
GTTGGCGACCAGATCAACATTGGCAAATTTTGACTGACAAAGACACTGGAATCATTGGTCCTGACGGTCAACCTC
TCAAAGTCGATTCTATCGTCCCGGGATGCCCCGACGGCCAGCTCGTCGCCGTCATTGACAGTGGGTGAGTAAAGA
TACCCTCGAATATTCTGTCGCTCACAAGACAATATACCAGATTTACATTTTCTCAAGTTCCTCGTGACATCTCTG
ACCAGATCTATGGTCGTGTCAAAGGCGCTTACTATGATACCAATCAAGAGTTCTGGATGATACCTTGTCAGCAGT
CGCTCAACATCACTTTCAGTTTCGGTGGAAAATCTTATCCCGTACATCCCCTCGATACCGTGGACGACAACTTTA
ACCAAGTTGATTCCACCGGTCAGAAAGTTTGTATCGGATCTGTAAGTATTTGCCTTGCGGGCATTTAACCTATCC
CTGATGTTATTCTTTAGTTCCAACCCATCACCTCCGCATTCTCCATGCTCGGCCACTATGACATGATTCTCGGCA
TGAGTTTCCGTAGGTCTTATTTTTCGTGCAAGAGTTTAAGCTCAACGCCTGTTTTAGTCCGTAATGCGTATACCC
TTCTCAACTTCGGCAATTGGATTGATAGCTCTTCCAAAACACAAGAACACCCGTTCATCCAACTCGCGTCAATCA
CCAACGTGGACCAGGCTCACGCCGACTTCGTCAAAGTCCGGCTTGGGGGAATTGATACTAGCGGTGCTGCGCAGT
ACCAGCTGCTACCTGTCGACCAGATGAAACGCTCACCGGTGTCTGATGAGGAAAAAAAGAAAAAATACCAGGAGA
TGATTCTGAGTCGATGGCCGTATATCTTTGTCGGGTGCTTAGTGTTTGTGCTTCTGATCACGGGCTATTGTGTCT
GGAGGTGTTGTTGCAGGAAGAGTAAAAAGCAAGGCAATAGTAAGTTGGGAGGTTTATTCAAGCGGAATCGCAGCG
AGAATGGTGGTGGGAACAGAGCTCTGGAGGAGACGGAAGTTGGGTTCCACAGCCAGAAGGGAGATAGTGAAAACT
CAAAGTATCACCCCCTGTCCGATTCAAACAACCTCAGTATGCAGGACCTTCATCGAACGAACACAGATCACTCGC
AGCGATCCTTCCCACCACCACCATCGTATCCGAATAACCCCTATCCGCAGGGTTATCACGATGGAAGCACATACT
CGTTACAAGGGAACGCTGCCGATGGTTATCCTCAATCTACCTATGTTATGAACCCACATGCTATGGATAGTGTTG
CGAGCGTACACATGCAAAGACAACCCCAACCCCACGATTTTAGCGGTGGATATAGTGGTAATGAGTTTGCTGCTC
GGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail