Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|101310
Gene name
Locationscaffold_07:972184..973544
Strand+
Gene length (bp)1360
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09139 Tam41_Mmp37 Phosphatidate cytidylyltransferase, mitochondrial 7.2E-113 90 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6DJM2|TAM41_XENLA Phosphatidate cytidylyltransferase, mitochondrial OS=Xenopus laevis GN=tamm41 PE=2 SV=1 80 409 2.0E-66
sp|P53230|TAM41_YEAST Phosphatidate cytidylyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAM41 PE=1 SV=1 69 406 4.0E-61
sp|Q3B7H2|TAM41_DANRE Phosphatidate cytidylyltransferase, mitochondrial OS=Danio rerio GN=tamm41 PE=2 SV=1 80 413 7.0E-60
sp|O74339|TAM41_SCHPO Phosphatidate cytidylyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tam41 PE=1 SV=3 48 409 2.0E-59
sp|Q3TUH1|TAM41_MOUSE Phosphatidate cytidylyltransferase, mitochondrial OS=Mus musculus GN=Tamm41 PE=1 SV=2 90 413 2.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6DJM2|TAM41_XENLA Phosphatidate cytidylyltransferase, mitochondrial OS=Xenopus laevis GN=tamm41 PE=2 SV=1 80 409 2.0E-66
sp|P53230|TAM41_YEAST Phosphatidate cytidylyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAM41 PE=1 SV=1 69 406 4.0E-61
sp|Q3B7H2|TAM41_DANRE Phosphatidate cytidylyltransferase, mitochondrial OS=Danio rerio GN=tamm41 PE=2 SV=1 80 413 7.0E-60
sp|O74339|TAM41_SCHPO Phosphatidate cytidylyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tam41 PE=1 SV=3 48 409 2.0E-59
sp|Q3TUH1|TAM41_MOUSE Phosphatidate cytidylyltransferase, mitochondrial OS=Mus musculus GN=Tamm41 PE=1 SV=2 90 413 2.0E-59
sp|Q32L81|TAM41_BOVIN Phosphatidate cytidylyltransferase, mitochondrial OS=Bos taurus GN=TAMM41 PE=2 SV=1 93 413 7.0E-57
sp|Q96BW9|TAM41_HUMAN Phosphatidate cytidylyltransferase, mitochondrial OS=Homo sapiens GN=TAMM41 PE=1 SV=2 80 395 6.0E-51
sp|Q8INF2|TAM41_DROME Phosphatidate cytidylyltransferase, mitochondrial OS=Drosophila melanogaster GN=CG33331 PE=2 SV=1 89 412 7.0E-47
sp|Q550P4|TAM41_DICDI Phosphatidate cytidylyltransferase, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0277049 PE=3 SV=1 100 402 2.0E-39
sp|Q9N4G7|TAM41_CAEEL Phosphatidate cytidylyltransferase, mitochondrial OS=Caenorhabditis elegans GN=Y71F9B.2 PE=3 SV=2 101 410 6.0E-35
sp|Q61X59|TAM41_CAEBR Phosphatidate cytidylyltransferase, mitochondrial OS=Caenorhabditis briggsae GN=CBG04116 PE=3 SV=1 101 410 2.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0004605 phosphatidate cytidylyltransferase activity Yes
GO:0032049 cardiolipin biosynthetic process Yes
GO:0045017 glycerolipid biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0032048 cardiolipin metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0046471 phosphatidylglycerol metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0070567 cytidylyltransferase activity No
GO:0009058 biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0044255 cellular lipid metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0006655 phosphatidylglycerol biosynthetic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0046486 glycerolipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|101310
MLAAAARRPSLATVVLVRRFATEPVAAGSNSHSSSPPPPLPTSKPRSHLYPHPRPAKSQQLPRNSNLPRLPPTFG
RNQLLPVTDATRALLEDVVAKFNAPIRYAFAYGSGVFEQDGREQDAETPMLDFMFAVTHPAHFHYINMQQYPAHY
PMHARMLGSSYVERVEDIGPGVWFNAYVPMNGKVIKYGVTSIDNLCNDLLNWRTLYLAGRMHKPLRIIKDDARVR
LTQQVNLTSAVRAALLTLPDQFSETQLFETIAAISYNGDPRMVLPAENRGKVGNIVRKQGPQFKELYQRLLVGLP
GTHWPTHLNGIKQDTSPHARTYHLRKLPHNLLIRVRSRFSERGVSEELLKEDENAYWLKLTADEEVLRKVIMEEI
GKIVRGPATVQSMKGIVTAGIGKSIKYGTTKIGKWWSGS*
Coding >Agabi119p4|101310
ATGCTCGCCGCTGCAGCTCGAAGGCCATCGCTCGCCACCGTCGTCCTCGTCCGCCGCTTTGCTACAGAACCAGTC
GCTGCAGGCAGTAACTCTCATTCCTCGTCGCCCCCTCCACCACTCCCGACTTCCAAACCCCGATCTCACCTCTAT
CCTCATCCTCGACCCGCTAAATCTCAGCAGCTACCCCGCAATTCTAATTTACCCCGACTACCTCCTACATTTGGT
CGTAATCAACTGTTACCCGTGACAGATGCCACACGAGCGCTGCTAGAGGATGTCGTGGCCAAGTTCAACGCACCT
ATACGATATGCCTTTGCGTATGGGTCAGGGGTGTTCGAGCAAGATGGCCGGGAACAAGATGCCGAAACACCGATG
TTGGATTTTATGTTCGCAGTGACCCATCCAGCACATTTTCACTATATCAATATGCAACAGTACCCGGCACATTAC
CCCATGCACGCGAGAATGCTTGGGTCGAGTTATGTCGAGAGAGTAGAGGATATAGGGCCAGGAGTATGGTTCAAT
GCCTACGTCCCTATGAACGGTAAAGTGATCAAATACGGTGTCACCAGCATTGATAACCTATGCAACGATCTACTC
AATTGGCGTACTTTATACCTGGCCGGTCGCATGCACAAGCCTCTACGGATCATCAAAGACGATGCTCGTGTGCGA
TTAACCCAACAAGTCAACCTCACGTCCGCAGTACGCGCGGCACTCCTTACACTCCCGGATCAATTCTCGGAAACG
CAGCTGTTCGAAACTATCGCTGCCATTTCATATAATGGTGATCCAAGAATGGTTCTTCCTGCGGAAAATCGTGGA
AAGGTTGGGAATATTGTTCGTAAACAGGGACCGCAATTTAAAGAATTGTATCAACGACTTCTGGTTGGACTTCCT
GGGACTCATTGGCCGACACATTTGAATGGAATCAAACAAGACACGAGTCCCCATGCCAGAACCTATCATCTTCGC
AAATTACCGCATAACTTGCTGATTCGGGTCCGGAGTCGGTTTTCGGAAAGAGGTGTGAGTGAAGAATTGTTGAAA
GAGGATGAGAATGCCTATTGGTTAAAGTTGACCGCGGATGAAGAAGTGTTGAGGAAGGTGATTATGGAGGAAATA
GGTAAGATTGTTAGGGGTCCTGCGACGGTGCAGTCGATGAAGGGAATTGTAACGGCTGGCATCGGGAAGAGCATC
AAGTATGGTACGACGAAGATTGGCAAGTGGTGGAGCGGTTCGTGA
Transcript >Agabi119p4|101310
ATGCTCGCCGCTGCAGCTCGAAGGCCATCGCTCGCCACCGTCGTCCTCGTCCGCCGCTTTGCTACAGAACCAGTC
GCTGCAGGCAGTAACTCTCATTCCTCGTCGCCCCCTCCACCACTCCCGACTTCCAAACCCCGATCTCACCTCTAT
CCTCATCCTCGACCCGCTAAATCTCAGCAGCTACCCCGCAATTCTAATTTACCCCGACTACCTCCTACATTTGGT
CGTAATCAACTGTTACCCGTGACAGATGCCACACGAGCGCTGCTAGAGGATGTCGTGGCCAAGTTCAACGCACCT
ATACGATATGCCTTTGCGTATGGGTCAGGGGTGTTCGAGCAAGATGGCCGGGAACAAGATGCCGAAACACCGATG
TTGGATTTTATGTTCGCAGTGACCCATCCAGCACATTTTCACTATATCAATATGCAACAGTACCCGGCACATTAC
CCCATGCACGCGAGAATGCTTGGGTCGAGTTATGTCGAGAGAGTAGAGGATATAGGGCCAGGAGTATGGTTCAAT
GCCTACGTCCCTATGAACGGTAAAGTGATCAAATACGGTGTCACCAGCATTGATAACCTATGCAACGATCTACTC
AATTGGCGTACTTTATACCTGGCCGGTCGCATGCACAAGCCTCTACGGATCATCAAAGACGATGCTCGTGTGCGA
TTAACCCAACAAGTCAACCTCACGTCCGCAGTACGCGCGGCACTCCTTACACTCCCGGATCAATTCTCGGAAACG
CAGCTGTTCGAAACTATCGCTGCCATTTCATATAATGGTGATCCAAGAATGGTTCTTCCTGCGGAAAATCGTGGA
AAGGTTGGGAATATTGTTCGTAAACAGGGACCGCAATTTAAAGAATTGTATCAACGACTTCTGGTTGGACTTCCT
GGGACTCATTGGCCGACACATTTGAATGGAATCAAACAAGACACGAGTCCCCATGCCAGAACCTATCATCTTCGC
AAATTACCGCATAACTTGCTGATTCGGGTCCGGAGTCGGTTTTCGGAAAGAGGTGTGAGTGAAGAATTGTTGAAA
GAGGATGAGAATGCCTATTGGTTAAAGTTGACCGCGGATGAAGAAGTGTTGAGGAAGGTGATTATGGAGGAAATA
GGTAAGATTGTTAGGGGTCCTGCGACGGTGCAGTCGATGAAGGGAATTGTAACGGCTGGCATCGGGAAGAGCATC
AAGTATGGTACGACGAAGATTGGCAAGTGGTGGAGCGGTTCGTGA
Gene >Agabi119p4|101310
ATGCTCGCCGCTGCAGCTCGAAGGCCATCGCTCGCCACCGTCGTCCTCGTCCGCCGCTTTGCTACAGAACCAGTC
GCTGCAGGCAGTAACTCTCATTCCTCGTCGCCCCCTCCACCACTCCCGACTTCCAAACCCCGATCTCACCTCTAT
CCTCATCCTCGACCCGCTAAATCTCAGCAGCTACCCCGCAATTCTAATTTACCCCGACTACCTCCTACATTTGGT
CGTAATCAACTGTTACCCGTGACAGATGCCACACGAGCGCTGCTAGAGGATGTCGTGGCCAAGTTCAACGCACCT
ATACGATATGCCTTTGCGTATGGGTCAGGGGTGTTCGAGCAAGATGGCCGGGAACAAGATGCCGAAACACCGATG
TTGGATTTTATGTTCGCAGTGACCCATCCAGCACATTTTCACTATATCAATATGCAACAGTACCCGGCACATTAC
CCCATGCACGCGAGAATGCTTGGGTCGAGTTATGTCGAGAGAGTAGAGGATATAGGGCCAGGAGTATGGTTCAAT
GCCTACGTCCCTATGAACGGTAAAGTAAGCTATCTATTTCGTCTCTTCCTCCCTGTCCATCTTTTCGCGAGCTTG
TTGAGCGGAGGGTCGGGAAGTGTTCGTGTCGCCGAGCTGACTCGCGGAATTTTGATCCGATTAGGTGATCAAATA
CGGTGTCACCAGCATTGATAACCTATGCAACGATCTACTCAATTGGCGTACTTTATACCTGGCCGGTCGCATGCA
CAAGCCTCTACGGATCATCAAAGACGATGCTCGTGTGCGATTAACCCAACAAGTCAACCTCACGTCCGCAGTACG
CGCGGCACTCCTTACACTCCCGGATCAATTCTCGGAAACGCAGCTGTTCGAAACTATCGCTGCCATTTCATATAA
TGGTGATCCAAGAATGGTTCTTCCTGCGGAAAATCGTGGAAAGGTTGGGAATATTGTTCGTAAACAGGGACCGCA
ATTTAAAGAATTGTATCAACGACTTCTGGTTGGACTTCCTGGGACTCATTGGCCGACACATTTGAATGGAATCAA
ACAAGACACGAGTCCCCATGCCAGAACCTATCATCTTCGCAAATTACCGCATAACTTGCTGATTCGGGTCCGGAG
TCGGTTTTCGGAAAGAGGTGTGAGTGAAGAATTGTTGAAAGAGGATGAGAATGCCTATTGGTTAAAGTTGACCGC
GGATGAAGAAGTGTTGAGGAAGGTGATTATGGAGGAAATAGGTAAGATTGTTAGGGGTCCTGCGACGGTGCAGTC
GATGAAGGGAATTGTAACGGCTGGCATCGGGAAGAGCATCAAGTATGGTACGACGAAGATTGGCAAGTGGTGGAG
CGGTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail