Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|101300
Gene name
Locationscaffold_07:969059..972072
Strand+
Gene length (bp)3013
Transcript length (bp)2574
Coding sequence length (bp)2574
Protein length (aa) 858

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 3.7E-133 291 771

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43053|ALG6_SCHPO Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg6 PE=3 SV=1 284 773 1.0E-117
sp|Q12001|ALG6_YEAST Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG6 PE=1 SV=1 281 772 2.0E-110
sp|Q3TAE8|ALG6_MOUSE Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg6 PE=2 SV=1 293 766 2.0E-89
sp|Q3T1L5|ALG6_RAT Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Rattus norvegicus GN=Alg6 PE=2 SV=1 293 766 5.0E-89
sp|Q9Y672|ALG6_HUMAN Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG6 PE=1 SV=1 281 766 1.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43053|ALG6_SCHPO Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg6 PE=3 SV=1 284 773 1.0E-117
sp|Q12001|ALG6_YEAST Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG6 PE=1 SV=1 281 772 2.0E-110
sp|Q3TAE8|ALG6_MOUSE Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg6 PE=2 SV=1 293 766 2.0E-89
sp|Q3T1L5|ALG6_RAT Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Rattus norvegicus GN=Alg6 PE=2 SV=1 293 766 5.0E-89
sp|Q9Y672|ALG6_HUMAN Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG6 PE=1 SV=1 281 766 1.0E-87
sp|Q5NVS8|ALG6_PONAB Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Pongo abelii GN=ALG6 PE=2 SV=1 281 766 6.0E-86
sp|Q9VKX7|ALG6_DROME Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster GN=gny PE=2 SV=2 288 771 1.0E-80
sp|Q802T2|ALG6_CHICK Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus GN=ALG6 PE=2 SV=1 282 755 2.0E-79
sp|Q54QG6|ALG6_DICDI Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum GN=alg6 PE=3 SV=1 282 711 2.0E-79
sp|Q9FF17|ALG6_ARATH Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana GN=At5g38460 PE=2 SV=1 272 767 4.0E-78
sp|Q09226|ALG6_CAEEL Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Caenorhabditis elegans GN=C08B11.8 PE=3 SV=1 294 771 6.0E-69
sp|Q9BVK2|ALG8_HUMAN Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG8 PE=1 SV=2 291 689 2.0E-25
sp|Q6BRE5|ALG8_DEBHA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG8 PE=3 SV=1 305 662 4.0E-25
sp|Q0P5D9|ALG8_BOVIN Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Bos taurus GN=ALG8 PE=2 SV=1 291 689 3.0E-24
sp|O80505|ALG8_ARATH Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana GN=At2g44660 PE=2 SV=3 313 691 6.0E-23
sp|Q9W3V8|ALG8_DROME Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster GN=xit PE=2 SV=1 305 689 6.0E-23
sp|Q10479|ALG8_SCHPO Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg8 PE=3 SV=1 313 660 1.0E-22
sp|Q5AJD2|ALG8_CANAL Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG8 PE=3 SV=1 305 662 2.0E-22
sp|P52887|ALG8_CAEEL Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Caenorhabditis elegans GN=C08H9.3 PE=3 SV=3 285 689 2.0E-22
sp|Q4IJT0|ALG8_GIBZE Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG8 PE=3 SV=1 313 660 2.0E-22
sp|Q6FKM3|ALG8_CANGA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG8 PE=3 SV=1 291 691 2.0E-22
sp|Q6P8H8|ALG8_MOUSE Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg8 PE=2 SV=2 291 689 6.0E-22
sp|Q554E2|ALG8_DICDI Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum GN=alg8 PE=3 SV=1 313 689 3.0E-21
sp|Q759R3|ALG8_ASHGO Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG8 PE=3 SV=2 289 689 1.0E-20
sp|Q6CJR2|ALG8_KLULA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG8 PE=3 SV=1 313 691 2.0E-20
sp|Q5AWM9|ALG8_EMENI Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alg8 PE=3 SV=1 313 660 2.0E-19
sp|P40351|ALG8_YEAST Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG8 PE=1 SV=1 313 691 4.0E-19
sp|Q1DJR8|ALG8_COCIM Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Coccidioides immitis (strain RS) GN=ALG8 PE=3 SV=1 313 660 3.0E-18
sp|Q2UB20|ALG8_ASPOR Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg8 PE=3 SV=1 313 660 5.0E-18
sp|Q7RXP5|ALG8_NEUCR Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-8 PE=3 SV=2 313 660 7.0E-16
sp|Q2HA14|ALG8_CHAGB Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ALG8 PE=3 SV=1 313 660 3.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0016758 hexosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016757 glycosyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 280 302 22
2 347 369 22
3 382 403 21
4 418 437 19
5 444 466 22
6 476 498 22
7 505 527 22
8 578 600 22
9 621 643 22
10 670 689 19
11 694 711 17
12 721 743 22
13 755 773 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|101300
MDIHTSVPPSSKRMSHSRGSQRSRGSFVNPPSIYTNPSPVTSRGDSPTNLRSQGLAGTYSGYSGPYRMTPGKYQP
PQRKLDILAPVPRRHLIDGNASSTWLGARGGEDSDPRNSETVTPPLSSANLYSRETSLPPDSPPKSALYSVHHQH
SPTRARSPRLFRDSSANHTTAPAGTTKILAQQELGASTSSPSFVSPQGGQTLRSRRLSDQSFSTLFLNQQLHAKE
REKEGSVGLLRSSHSSSTLLQRRQHRHGQEVGEEREKEGIGRAWIRWMHKRGIRAWIIPLLVFTSTLVKFCISLG
SYSGHSTPPMYGDYEAQRHWMELTLHLPFRLWYSYDLQYWGLDYPPLTAYVSWICGVIAHWINPTWVALDASRGI
ETEGSKIFMRSTVVAWDMLVYVPALLVFSRVWHGNRSGRTQELALLTLLFHPALLLIDFGHFQYNSVMLGFTVLA
MNFFATGQDLAGAAFFTLSLGFKQMALYYAPGIGSYLLARCVFLGIPGPGFKHFTRLAITTISCFMVLFLPFYLP
PFAPSFMHILNPISRIFPFNRGLFEDKVANFWCASNVVLKWRERVSRSMLVKFSAGLTALGFLPSVGVMLNSGWR
MRMSAASNVAEREQEDQEKQTPFLPLLPYALLTSSFSFFLFSFQVHEKTILVPLLPMTLLLSGAPVDSSVYAWGV
LVNNIGVFSMWPLLKKDGLGFQYIALLILWNRIIGYNPLRLPSGTLVQLLSLVTYTAAIGLHVLEFFFNPPSRYP
DIYPVLNVLISTPVFVLAWLWSIKCGVEVGWAIGGPGPASVSPTSASTTGDSIGRRAGSVGLGAGEEGVVMEGSF
RQKGGRAVSLGTSQVNRRKKVGVKSRMGEEWM*
Coding >Agabi119p4|101300
ATGGACATCCACACCTCCGTGCCACCCTCCTCTAAACGCATGTCACATTCCCGTGGATCACAGCGTAGTCGTGGT
TCCTTCGTGAATCCTCCGTCAATTTATACCAATCCAAGTCCTGTAACGTCGCGAGGCGACTCTCCTACCAACCTA
CGCTCCCAAGGGCTGGCAGGAACTTACAGTGGATATTCGGGACCATACAGAATGACTCCCGGAAAATATCAACCA
CCCCAGAGAAAGCTAGATATCCTAGCACCTGTACCGAGGAGGCACCTCATTGATGGTAATGCAAGTTCGACGTGG
CTAGGAGCCAGGGGTGGAGAAGATTCAGATCCCAGAAATTCCGAGACGGTTACTCCTCCATTATCCTCAGCAAAC
CTTTATTCTCGAGAGACATCACTTCCTCCCGACTCGCCGCCGAAGTCAGCGTTATATTCTGTTCATCATCAACAT
TCACCTACACGCGCTCGGTCACCACGGCTGTTCCGCGATTCATCAGCAAATCATACTACCGCTCCAGCCGGGACT
ACGAAGATTTTGGCACAACAAGAACTTGGTGCATCAACTTCGAGTCCAAGTTTCGTATCACCGCAAGGCGGTCAA
ACGCTTCGGAGTAGAAGGCTCTCGGACCAGTCGTTTAGTACATTATTTCTTAATCAACAGCTTCATGCGAAGGAA
CGTGAAAAGGAAGGTAGTGTTGGTCTGCTGCGTTCGAGCCATTCTTCGTCGACTCTCCTCCAGCGGCGTCAACAT
AGACATGGCCAGGAAGTAGGCGAGGAAAGAGAAAAAGAGGGGATAGGTAGGGCGTGGATAAGGTGGATGCATAAA
CGTGGAATCCGAGCTTGGATTATTCCATTACTTGTGTTCACGTCAACCTTGGTCAAGTTTTGCATCAGCTTAGGC
TCGTATTCTGGCCACAGTACGCCACCCATGTATGGAGACTATGAAGCACAAAGGCATTGGATGGAGTTGACCTTG
CATTTGCCTTTCCGTCTATGGTATAGTTATGACCTCCAGTATTGGGGTTTAGACTATCCTCCTCTAACGGCATAT
GTCTCTTGGATATGTGGCGTGATTGCGCATTGGATAAATCCAACATGGGTCGCGCTGGATGCTTCTCGAGGCATT
GAAACTGAAGGAAGTAAAATATTTATGAGATCTACCGTCGTTGCATGGGACATGCTAGTCTATGTCCCTGCACTT
CTGGTGTTTTCGAGGGTATGGCACGGAAACCGATCCGGCCGAACGCAGGAACTGGCTCTGTTAACGTTGCTCTTC
CATCCAGCCCTTCTCTTGATTGATTTTGGTCACTTTCAGTACAACTCGGTCATGCTTGGTTTCACCGTACTTGCG
ATGAATTTCTTTGCTACCGGACAAGATCTGGCTGGTGCTGCATTTTTCACCTTGAGCCTCGGCTTCAAGCAGATG
GCCTTGTATTACGCTCCCGGTATCGGTTCATATTTGCTGGCAAGATGTGTATTTCTCGGTATTCCGGGTCCTGGT
TTTAAACACTTCACGCGCCTTGCCATTACCACCATCTCTTGCTTCATGGTCCTTTTTCTGCCATTCTACCTCCCA
CCTTTCGCTCCATCTTTCATGCACATTCTGAATCCCATTTCACGGATATTCCCGTTCAATCGGGGTTTGTTTGAA
GACAAAGTTGCAAATTTTTGGTGTGCGAGTAATGTGGTACTCAAGTGGCGCGAGCGTGTGAGCAGGAGTATGTTG
GTCAAGTTTTCTGCCGGTTTGACTGCACTTGGATTTTTGCCAAGTGTGGGTGTTATGTTAAATTCGGGATGGAGG
ATGCGTATGTCTGCCGCTTCAAATGTTGCGGAGAGAGAGCAAGAGGATCAAGAGAAGCAGACGCCCTTTCTTCCG
CTTCTGCCGTACGCGCTATTGACATCGTCTTTTTCATTCTTTTTGTTCTCGTTCCAAGTTCACGAGAAAACCATA
CTTGTTCCGCTGTTGCCTATGACGCTCTTATTGTCTGGTGCTCCTGTGGATTCATCAGTCTATGCATGGGGTGTG
TTGGTCAATAATATTGGCGTCTTCAGCATGTGGCCACTACTCAAAAAAGATGGACTCGGTTTTCAGTATATTGCT
TTATTAATTCTTTGGAATCGAATCATTGGATACAATCCACTTCGCTTGCCATCTGGCACGCTTGTGCAGCTACTC
TCGCTCGTTACGTATACTGCAGCAATAGGACTTCATGTTCTAGAGTTTTTCTTCAACCCACCGTCACGATATCCC
GATATATACCCAGTCTTGAATGTGCTCATAAGCACACCCGTGTTCGTTCTGGCGTGGCTATGGAGCATCAAGTGC
GGAGTTGAAGTGGGCTGGGCGATTGGTGGACCGGGGCCTGCCTCAGTTAGCCCAACATCGGCATCGACCACAGGG
GATTCGATTGGCAGGAGAGCGGGGAGCGTCGGCCTAGGTGCGGGCGAGGAGGGTGTGGTTATGGAGGGAAGTTTC
CGGCAGAAAGGAGGTAGGGCAGTGAGCCTTGGAACTAGCCAAGTTAATCGGCGGAAGAAAGTCGGGGTGAAGAGT
CGGATGGGTGAGGAGTGGATGTAG
Transcript >Agabi119p4|101300
ATGGACATCCACACCTCCGTGCCACCCTCCTCTAAACGCATGTCACATTCCCGTGGATCACAGCGTAGTCGTGGT
TCCTTCGTGAATCCTCCGTCAATTTATACCAATCCAAGTCCTGTAACGTCGCGAGGCGACTCTCCTACCAACCTA
CGCTCCCAAGGGCTGGCAGGAACTTACAGTGGATATTCGGGACCATACAGAATGACTCCCGGAAAATATCAACCA
CCCCAGAGAAAGCTAGATATCCTAGCACCTGTACCGAGGAGGCACCTCATTGATGGTAATGCAAGTTCGACGTGG
CTAGGAGCCAGGGGTGGAGAAGATTCAGATCCCAGAAATTCCGAGACGGTTACTCCTCCATTATCCTCAGCAAAC
CTTTATTCTCGAGAGACATCACTTCCTCCCGACTCGCCGCCGAAGTCAGCGTTATATTCTGTTCATCATCAACAT
TCACCTACACGCGCTCGGTCACCACGGCTGTTCCGCGATTCATCAGCAAATCATACTACCGCTCCAGCCGGGACT
ACGAAGATTTTGGCACAACAAGAACTTGGTGCATCAACTTCGAGTCCAAGTTTCGTATCACCGCAAGGCGGTCAA
ACGCTTCGGAGTAGAAGGCTCTCGGACCAGTCGTTTAGTACATTATTTCTTAATCAACAGCTTCATGCGAAGGAA
CGTGAAAAGGAAGGTAGTGTTGGTCTGCTGCGTTCGAGCCATTCTTCGTCGACTCTCCTCCAGCGGCGTCAACAT
AGACATGGCCAGGAAGTAGGCGAGGAAAGAGAAAAAGAGGGGATAGGTAGGGCGTGGATAAGGTGGATGCATAAA
CGTGGAATCCGAGCTTGGATTATTCCATTACTTGTGTTCACGTCAACCTTGGTCAAGTTTTGCATCAGCTTAGGC
TCGTATTCTGGCCACAGTACGCCACCCATGTATGGAGACTATGAAGCACAAAGGCATTGGATGGAGTTGACCTTG
CATTTGCCTTTCCGTCTATGGTATAGTTATGACCTCCAGTATTGGGGTTTAGACTATCCTCCTCTAACGGCATAT
GTCTCTTGGATATGTGGCGTGATTGCGCATTGGATAAATCCAACATGGGTCGCGCTGGATGCTTCTCGAGGCATT
GAAACTGAAGGAAGTAAAATATTTATGAGATCTACCGTCGTTGCATGGGACATGCTAGTCTATGTCCCTGCACTT
CTGGTGTTTTCGAGGGTATGGCACGGAAACCGATCCGGCCGAACGCAGGAACTGGCTCTGTTAACGTTGCTCTTC
CATCCAGCCCTTCTCTTGATTGATTTTGGTCACTTTCAGTACAACTCGGTCATGCTTGGTTTCACCGTACTTGCG
ATGAATTTCTTTGCTACCGGACAAGATCTGGCTGGTGCTGCATTTTTCACCTTGAGCCTCGGCTTCAAGCAGATG
GCCTTGTATTACGCTCCCGGTATCGGTTCATATTTGCTGGCAAGATGTGTATTTCTCGGTATTCCGGGTCCTGGT
TTTAAACACTTCACGCGCCTTGCCATTACCACCATCTCTTGCTTCATGGTCCTTTTTCTGCCATTCTACCTCCCA
CCTTTCGCTCCATCTTTCATGCACATTCTGAATCCCATTTCACGGATATTCCCGTTCAATCGGGGTTTGTTTGAA
GACAAAGTTGCAAATTTTTGGTGTGCGAGTAATGTGGTACTCAAGTGGCGCGAGCGTGTGAGCAGGAGTATGTTG
GTCAAGTTTTCTGCCGGTTTGACTGCACTTGGATTTTTGCCAAGTGTGGGTGTTATGTTAAATTCGGGATGGAGG
ATGCGTATGTCTGCCGCTTCAAATGTTGCGGAGAGAGAGCAAGAGGATCAAGAGAAGCAGACGCCCTTTCTTCCG
CTTCTGCCGTACGCGCTATTGACATCGTCTTTTTCATTCTTTTTGTTCTCGTTCCAAGTTCACGAGAAAACCATA
CTTGTTCCGCTGTTGCCTATGACGCTCTTATTGTCTGGTGCTCCTGTGGATTCATCAGTCTATGCATGGGGTGTG
TTGGTCAATAATATTGGCGTCTTCAGCATGTGGCCACTACTCAAAAAAGATGGACTCGGTTTTCAGTATATTGCT
TTATTAATTCTTTGGAATCGAATCATTGGATACAATCCACTTCGCTTGCCATCTGGCACGCTTGTGCAGCTACTC
TCGCTCGTTACGTATACTGCAGCAATAGGACTTCATGTTCTAGAGTTTTTCTTCAACCCACCGTCACGATATCCC
GATATATACCCAGTCTTGAATGTGCTCATAAGCACACCCGTGTTCGTTCTGGCGTGGCTATGGAGCATCAAGTGC
GGAGTTGAAGTGGGCTGGGCGATTGGTGGACCGGGGCCTGCCTCAGTTAGCCCAACATCGGCATCGACCACAGGG
GATTCGATTGGCAGGAGAGCGGGGAGCGTCGGCCTAGGTGCGGGCGAGGAGGGTGTGGTTATGGAGGGAAGTTTC
CGGCAGAAAGGAGGTAGGGCAGTGAGCCTTGGAACTAGCCAAGTTAATCGGCGGAAGAAAGTCGGGGTGAAGAGT
CGGATGGGTGAGGAGTGGATGTAG
Gene >Agabi119p4|101300
ATGGACATCCACACCTCCGTGCCACCCTCCTCTAAACGCATGTCACATTCCCGTGGATCACAGCGTAGTCGTGGT
TCCTTCGTGAATCCTCCGTCAATTTATACCAATCCAAGTCCTGTAACGTCGCGAGGCGACTCTCCTACCAACCTA
CGCTCCCAAGGGCTGGCAGGAACTTACAGTGGATATTCGGGACCATACAGAATGACTCCCGGAAAATATCAACCA
CCCCAGTATGTCCTTTGTTCACCTGATTTTAGCTTTCCAACTGGTGTGAAAGATACTCAAATCGCGCGGGTAGGA
GAAAGCTAGATATCCTAGCACCTGTACCGAGGAGGCACCTCATTGATGGTAATGCAAGTTCGACGTGGCTAGGAG
CCAGGGGTGGAGAAGATTCAGATCCCAGAAATTCCGAGACGGTTACTCCTCCATTATCCTCAGCAAACCTTTATT
CTCGAGAGACATCACTTCCTCCCGACTCGCCGCCGAAGTCAGCGTTATATTCTGTTCATCATCAACATTCACCTA
CACGCGCTCGGTCACCACGGCTGTTCCGCGATTCATCAGCAAATCATACTACCGCTCCAGCCGGGACTACGAAGA
TTTTGGCACAACAAGAACTTGGTGCATCAACTTCGAGTCCAAGTTTCGTATCACCGCAAGGCGGTCAAACGCTTC
GGAGTAGAAGGCTCTCGGACCAGTCGTTTAGTACATTATTTCTTAATCAACAGCTTCATGCGAAGGAACGTGAAA
AGGAAGGTAGTGTTGGTCTGCTGCGTTCGAGCCATTCTTCGTCGACTCTCCTCCAGCGGCGTCAACATAGACATG
GCCAGGAAGTAGGCGAGGAAAGAGAAAAAGAGGGGATAGGTAGGGCGTGGATAAGGTGGATGCATAAACGTGGAA
TCCGAGCTTGGATTATTCCATTACTTGTGTTCACGTCAACCTTGGTCAAGTTTTGCATCAGCTTAGGCTCGTATT
CTGGTACGTCCTCGTTTTGTTCACAGAGGAGTCAACTCAAGGTTTGCAGGCCACAGTACGCCACCCATGTATGGA
GACTATGAAGCACAAAGGCATTGGATGGAGTTGACCTTGCATTTGCCTTTCCGTCTATGGTATAGTTATGACCTC
CAGTATTGGGGTTTAGACTATCCTCCTCTAACGGCATATGTCTCTTGGATATGTGGCGTGATGTAAGTCTCTTTC
CTCATGCTTCCAGTTTTATTCATTAATATGTCCGATGAAACAGTGCGCATTGGATAAATCCAACATGGGTCGCGC
TGGATGCTTCTCGAGGCATTGAAACTGAAGGAAGTAAAATATTTATGAGATCTACCGTCGTTGCATGGGACATGC
TAGTCTATGTCCCTGCACTTCTGGTGTTTTCGAGGGTATGGCACGGAAACCGATCCGGCCGAACGCAGGTGAGTC
GTTTTTGTCTTCAGCCATGAGCATCCATGCTTAAAAAATAAACATAGGAACTGGCTCTGTTAACGTTGCTCTTCC
ATCCAGCCCTTCTCTTGATTGATTTTGGTCACTTTCAGTACAACTCGGTCATGCTTGGTACGGGAATTTTACTGA
TAAATTTTGTTTGTCCTTACCCTGATCTAGGTTTCACCGTACTTGCGATGAATTTCTTTGCTACCGGACAAGATC
TGGCTGGTGCTGCATTTTTCACCTTGAGCCTCGGCTTCAAGCAGATGGCCTTGTATTACGCTCCCGGTATCGGTT
CATATTTGCTGGCAAGATGTGTATTTCTCGGTATTCCGGGTCCTGGGTATGTTTTCTTATACTTTCATAATGACC
ACGCTGAGTATTTTCGTCTCGAAAGTTTTAAACACTTCACGCGCCTTGCCATTACCACCATCTCTTGCTTCATGG
TCCTTTTTCTGCCATTCTACCTCCCACCTTTCGCTCCATCTTTCATGCACATTCTGAATCCCATTTCACGGATAT
TCCCGTTCAATCGGGGTTTGTTTGAAGACAAAGTTGCAAATTTTTGGTGTGCGAGTAATGTGGTACTCAAGTGGC
GCGAGCGTGTGAGCAGGAGTATGTTGGTCAAGTTTTCTGCCGGTTTGACTGCACTTGGATTTTTGCCAAGTGTGG
GTGTTATGTTAAATTCGGGATGGAGGATGCGTATGTCTGCCGCTTCAAATGTTGCGGAGAGAGAGCAAGAGGATC
AAGAGAAGCAGACGCCCTTTCTTCCGCTTCTGCCGTACGCGCTATTGACATCGTCTTTTTCATTCTTTTTGTTCT
CGTTCCAAGTTCACGAGAAAACCATACTTGTTCCGCTGTTGCCTATGACGCTCTTATTGTCTGGTGCTCCTGTGG
ATTCATCAGTCTATGCATGGGGTGTGTTGGTCAATAATATTGGCGTCTTCAGGTGCGTAGATGCAGCTACTAGTC
ATATGCTCTTTTCGTTGATGATTCGGATATAGCATGTGGCCACTACTCAAAAAAGATGGACTCGGTTTTCAGTAT
ATTGCTTTATTAATTCTTTGGAATCGAATCATTGGATACAATCCACTTCGCTTGCCATCTGGCACGCTTGTGCAG
CTACTCTCGCTCGTGAGTGCCTTTCCTTCAATACTATAGCGCAAGCAGATTAAAATGATTCTGAATATAGGTTAC
GTATACTGCAGCAATAGGACTTCATGTTCTAGAGTTTTTCTTCAACCCACCGTCACGATATCCCGATATATACCC
AGTCTTGAATGTGCTCATAAGCACACCCGTGTTCGTTCTGGCGTGGCTATGGAGCATCAAGTGCGGAGTTGAAGT
GGGCTGGGCGATTGGTGGACCGGGGCCTGCCTCAGTTAGCCCAACATCGGCATCGACCACAGGGGATTCGATTGG
CAGGAGAGCGGGGAGCGTCGGCCTAGGTGCGGGCGAGGAGGGTGTGGTTATGGAGGGAAGTTTCCGGCAGAAAGG
AGGTAGGGCAGTGAGCCTTGGAACTAGCCAAGTTAATCGGCGGAAGAAAGTCGGGGTGAAGAGTCGGATGGGTGA
GGAGTGGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail