Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|101060
Gene name
Locationscaffold_07:908317..909194
Strand-
Gene length (bp)877
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10681 Rot1 Chaperone for protein-folding within the ER, fungal 4.0E-52 31 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6S3W1|ROT1_BOTFB Protein rot1 OS=Botryotinia fuckeliana (strain B05.10) GN=rot1 PE=3 SV=1 31 185 4.0E-35
sp|A7EX99|ROT1_SCLS1 Protein rot1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rot1 PE=3 SV=1 31 185 1.0E-34
sp|A2QMB8|ROT1_ASPNC Protein rot1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rot1 PE=3 SV=1 31 203 8.0E-34
sp|Q1DNE5|ROT1_COCIM Protein ROT1 OS=Coccidioides immitis (strain RS) GN=ROT1 PE=3 SV=1 31 201 2.0E-33
sp|Q2USD9|ROT1_ASPOR Protein rot1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rot1 PE=3 SV=2 31 201 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6S3W1|ROT1_BOTFB Protein rot1 OS=Botryotinia fuckeliana (strain B05.10) GN=rot1 PE=3 SV=1 31 185 4.0E-35
sp|A7EX99|ROT1_SCLS1 Protein rot1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rot1 PE=3 SV=1 31 185 1.0E-34
sp|A2QMB8|ROT1_ASPNC Protein rot1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rot1 PE=3 SV=1 31 203 8.0E-34
sp|Q1DNE5|ROT1_COCIM Protein ROT1 OS=Coccidioides immitis (strain RS) GN=ROT1 PE=3 SV=1 31 201 2.0E-33
sp|Q2USD9|ROT1_ASPOR Protein rot1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rot1 PE=3 SV=2 31 201 2.0E-33
sp|Q5AY94|ROT1_EMENI Protein rot1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rot1 PE=3 SV=1 1 201 3.0E-33
sp|Q755J8|ROT1_ASHGO Protein ROT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ROT1 PE=3 SV=2 8 209 8.0E-33
sp|Q0CJ00|ROT1_ASPTN Protein rot1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rot1 PE=3 SV=1 31 203 5.0E-31
sp|A1DCU0|ROT1_NEOFI Protein rot1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rot1 PE=3 SV=1 6 201 6.0E-31
sp|Q6CFU5|ROT1_YARLI Protein ROT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ROT1 PE=3 SV=1 31 202 3.0E-30
sp|A1CDT3|ROT1_ASPCL Protein rot1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rot1 PE=3 SV=1 31 208 5.0E-30
sp|A7TDM0|ROT1_VANPO Protein ROT1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ROT1 PE=3 SV=1 30 206 2.0E-29
sp|Q6BSD5|ROT1_DEBHA Protein ROT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROT1 PE=3 SV=1 24 202 4.0E-29
sp|O14103|ROT1_SCHPO Protein rot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rot1 PE=3 SV=1 19 185 6.0E-29
sp|A6RBY1|ROT1_AJECN Protein ROT1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ROT1 PE=3 SV=1 1 207 6.0E-29
sp|A5DN48|ROT1_PICGU Protein ROT1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ROT1 PE=3 SV=2 29 202 2.0E-28
sp|Q03691|ROT1_YEAST Protein ROT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT1 PE=1 SV=1 25 209 2.0E-27
sp|Q6FKL3|ROT1_CANGA Protein ROT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ROT1 PE=3 SV=1 31 185 2.0E-27
sp|Q6CL16|ROT1_KLULA Protein ROT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ROT1 PE=3 SV=1 31 205 4.0E-26
sp|A6ZMR2|ROT1_YEAS7 Protein ROT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ROT1 PE=3 SV=1 25 185 4.0E-26
sp|Q5ABP8|ROT1_CANAL Protein ROT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ROT1 PE=3 SV=1 3 199 6.0E-25
sp|A5DVH1|ROT1_LODEL Protein ROT1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ROT1 PE=3 SV=1 29 199 8.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0005783 endoplasmic reticulum Yes
GO:0006458 'de novo' protein folding Yes
GO:0043229 intracellular organelle No
GO:0043226 organelle No
GO:0043227 membrane-bounded organelle No
GO:0008150 biological_process No
GO:0006457 protein folding No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|101060
MLFTPVLGLVLASFTPVVYSQLPLEQAQQTLIGTWSSGSKHVLTGPGFANPANQSFNYPPTTGISYSFTDTFYEL
SRYRFNSNGSDPTCITGVIGWSHGKYQLNTNGSMTLFPFPDGYQQIQDPCAAVSNFIEDYRITEELYVQWAIFVD
PTFGPKLHLNQFDGAPLAPMFQVSSQPNMLPTQPLRNVSDPNADSESNVQRRGLSKSAL*
Coding >Agabi119p4|101060
ATGCTTTTCACCCCTGTTCTTGGCCTTGTCCTCGCCTCATTCACCCCCGTCGTTTACTCGCAGCTGCCTCTCGAG
CAGGCACAGCAGACCCTCATTGGCACATGGAGCTCTGGCAGTAAACATGTCTTGACTGGTCCAGGTTTCGCCAAC
CCTGCCAACCAGTCGTTCAACTATCCTCCGACTACCGGGATTTCGTACTCTTTCACCGATACGTTTTATGAACTT
TCACGCTATCGTTTTAACAGCAATGGTTCCGATCCCACCTGCATTACTGGTGTCATTGGCTGGTCTCATGGCAAA
TACCAACTCAATACCAATGGTTCCATGACCTTATTCCCGTTTCCCGACGGCTATCAACAAATTCAAGACCCATGT
GCAGCCGTCTCCAACTTCATCGAAGACTATAGGATCACAGAAGAGCTGTATGTGCAGTGGGCAATTTTCGTGGAC
CCAACTTTTGGCCCCAAACTTCATCTGAACCAGTTTGATGGTGCTCCGTTGGCTCCGATGTTCCAAGTTTCATCG
CAACCAAATATGCTTCCTACCCAACCACTTAGGAATGTTTCGGATCCGAACGCAGATTCTGAGTCGAATGTACAA
CGAAGAGGATTGTCGAAATCAGCACTATGA
Transcript >Agabi119p4|101060
ATGCTTTTCACCCCTGTTCTTGGCCTTGTCCTCGCCTCATTCACCCCCGTCGTTTACTCGCAGCTGCCTCTCGAG
CAGGCACAGCAGACCCTCATTGGCACATGGAGCTCTGGCAGTAAACATGTCTTGACTGGTCCAGGTTTCGCCAAC
CCTGCCAACCAGTCGTTCAACTATCCTCCGACTACCGGGATTTCGTACTCTTTCACCGATACGTTTTATGAACTT
TCACGCTATCGTTTTAACAGCAATGGTTCCGATCCCACCTGCATTACTGGTGTCATTGGCTGGTCTCATGGCAAA
TACCAACTCAATACCAATGGTTCCATGACCTTATTCCCGTTTCCCGACGGCTATCAACAAATTCAAGACCCATGT
GCAGCCGTCTCCAACTTCATCGAAGACTATAGGATCACAGAAGAGCTGTATGTGCAGTGGGCAATTTTCGTGGAC
CCAACTTTTGGCCCCAAACTTCATCTGAACCAGTTTGATGGTGCTCCGTTGGCTCCGATGTTCCAAGTTTCATCG
CAACCAAATATGCTTCCTACCCAACCACTTAGGAATGTTTCGGATCCGAACGCAGATTCTGAGTCGAATGTACAA
CGAAGAGGATTGTCGAAATCAGCACTATGA
Gene >Agabi119p4|101060
ATGCTTTTCACCCCTGTTCTTGGCCTTGTCCTCGCCTCATTCACCCCCGTCGTTTACTCGCAGCTGCCTCTCGAG
CAGGCACAGCAGACCCTCATTGGCACATGGAGCTCTGGCAGTAAACATGTCTTGACTGGTCCAGTAAGTCCTTGG
ATCCTTCAGCAGCGGTCTGAGTTTACCCCTTTACTTGCAGGGTTTCGCCAACCCTGCCAACCAGTCGTTCAACTA
TCCTCCGACTACCGGGATTTCGTACTCTTTGTGCGTAGCAAAAAACTCGATAACACTAAATAACCAGTCGCTGAA
TCTTTGCTTATGCAGCACCGATACGTTTTATGAACTTTCACGCTATCGTTTTAACAGCAATGGTGCGTGGCACTG
CCTTATCTCTCCCTCAGCTACTCATATTCGACGATATCCAGGTTCCGATCCCACCTGCATTACTGGTGTCATTGG
CTGGTCTCATGGCAAATACCAACTCAATACCAATGGTTCCATGACCTTATTCCCGTTTCCCGACGGCTATCAACA
AATTCAAGACCCATGTGCAGCCGTCTCCAACTTCATCGAAGACTATAGGATCACAGAAGAGCTGTATGTGCAGTG
GGCAATTTTCGTGGACCCAACTTTTGGCCCCAAACTTCATCTGAACCAGTTTGATGGTGCTCCGTTGGCTCCGAT
GTTCCAAGTTTCATCGCAACCAAATATGCTTCCTACCCAACCACTTAGGAATGTTTCGGATCCGAACGCAGATTC
TGAGTCGAATGTACAACGAAGAGGATTGTCGAAATCAGGTGCGCTCAGCAGTCGGCGGGTAGATAACGTGATGAC
GATGGGTGTTTCGGGATTGATTGTTGCCGCATTTGCTTCGCTAGCACTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail