Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|100430
Gene name
Locationscaffold_07:795688..796036
Strand+
Gene length (bp)348
Transcript length (bp)303
Coding sequence length (bp)303
Protein length (aa) 101

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05347 Complex1_LYR Complex 1 protein (LYR family) 2.7E-08 8 68

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9US02|SDHF1_SCHPO Succinate dehydrogenase assembly factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC664.12c PE=3 SV=1 1 80 6.0E-13
sp|Q3E785|SDHF1_YEAST Succinate dehydrogenase assembly factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH6 PE=1 SV=1 4 77 2.0E-10
sp|A6ZYX9|SDHF1_YEAS7 Succinate dehydrogenase assembly factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_1267 PE=3 SV=1 4 77 2.0E-10
sp|Q54HG5|SDHFA_DICDI Succinate dehydrogenase assembly factor 1A, mitochondrial OS=Dictyostelium discoideum GN=sdhaf1A PE=3 SV=1 1 72 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|100430
MKRSGLQKDVLALYRRALRMVKTKPQAAQHKFLLYIRYTFHQNAASISPRNVSAIEHLLRVGGRQIDMYENPGVK
DCFVSKDMMDWHEQWRKGSLSNTSV*
Coding >Agabi119p4|100430
ATGAAGCGGTCGGGTCTTCAAAAAGACGTCCTCGCTCTCTACAGGCGGGCACTTCGTATGGTGAAAACAAAACCC
CAGGCCGCCCAACACAAGTTTCTCCTCTACATTAGATATACCTTCCACCAAAACGCCGCCTCCATCTCGCCTCGT
AATGTCTCCGCCATAGAACATCTATTGCGTGTAGGAGGACGACAAATAGACATGTATGAAAACCCAGGCGTTAAG
GATTGTTTTGTGTCGAAGGATATGATGGATTGGCATGAACAATGGAGGAAAGGTTCTTTGTCAAACACCTCTGTT
TGA
Transcript >Agabi119p4|100430
ATGAAGCGGTCGGGTCTTCAAAAAGACGTCCTCGCTCTCTACAGGCGGGCACTTCGTATGGTGAAAACAAAACCC
CAGGCCGCCCAACACAAGTTTCTCCTCTACATTAGATATACCTTCCACCAAAACGCCGCCTCCATCTCGCCTCGT
AATGTCTCCGCCATAGAACATCTATTGCGTGTAGGAGGACGACAAATAGACATGTATGAAAACCCAGGCGTTAAG
GATTGTTTTGTGTCGAAGGATATGATGGATTGGCATGAACAATGGAGGAAAGGTTCTTTGTCAAACACCTCTGTT
TGA
Gene >Agabi119p4|100430
ATGAAGCGGTCGGGTCTTCAAAAAGACGTCCTCGCTCTCTACAGGCGGTGAGTGACACTACTTTGCACATATCTT
ATAACTCATATTCCTAGGGCACTTCGTATGGTGAAAACAAAACCCCAGGCCGCCCAACACAAGTTTCTCCTCTAC
ATTAGATATACCTTCCACCAAAACGCCGCCTCCATCTCGCCTCGTAATGTCTCCGCCATAGAACATCTATTGCGT
GTAGGAGGACGACAAATAGACATGTATGAAAACCCAGGCGTTAAGGATTGTTTTGTGTCGAAGGATATGATGGAT
TGGCATGAACAATGGAGGAAAGGTTCTTTGTCAAACACCTCTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail