Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|100230
Gene name
Locationscaffold_07:773014..774508
Strand+
Gene length (bp)1494
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01753 zf-MYND MYND finger 1.6E-07 51 91
PF00856 SET SET domain 9.2E-07 22 231

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GN68|SMY2B_XENLA N-lysine methyltransferase SMYD2-B OS=Xenopus laevis GN=smyd2-b PE=2 SV=1 22 257 2.0E-19
sp|E1C5V0|SMYD2_CHICK N-lysine methyltransferase SMYD2 OS=Gallus gallus GN=SMYD2 PE=3 SV=1 22 257 6.0E-19
sp|Q7ZXV5|SMY2A_XENLA N-lysine methyltransferase SMYD2-A OS=Xenopus laevis GN=smyd2-a PE=2 SV=1 22 257 3.0E-18
sp|Q8R5A0|SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus GN=Smyd2 PE=1 SV=1 29 257 2.0E-17
sp|Q7M6Z3|SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus GN=Smyd2 PE=1 SV=1 29 257 7.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GN68|SMY2B_XENLA N-lysine methyltransferase SMYD2-B OS=Xenopus laevis GN=smyd2-b PE=2 SV=1 22 257 2.0E-19
sp|E1C5V0|SMYD2_CHICK N-lysine methyltransferase SMYD2 OS=Gallus gallus GN=SMYD2 PE=3 SV=1 22 257 6.0E-19
sp|Q7ZXV5|SMY2A_XENLA N-lysine methyltransferase SMYD2-A OS=Xenopus laevis GN=smyd2-a PE=2 SV=1 22 257 3.0E-18
sp|Q8R5A0|SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus GN=Smyd2 PE=1 SV=1 29 257 2.0E-17
sp|Q7M6Z3|SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus GN=Smyd2 PE=1 SV=1 29 257 7.0E-17
sp|Q9NRG4|SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens GN=SMYD2 PE=1 SV=2 26 257 2.0E-16
sp|Q0P585|SMYD2_BOVIN N-lysine methyltransferase SMYD2 OS=Bos taurus GN=SMYD2 PE=2 SV=1 26 257 4.0E-16
sp|C3RZA1|SMYD2_PIG N-lysine methyltransferase SMYD2 OS=Sus scrofa GN=SMYD2 PE=2 SV=1 26 257 1.0E-15
sp|Q7XJS0|ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana GN=ASHR1 PE=2 SV=2 29 371 7.0E-15
sp|Q5RGL7|SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio GN=smyd2b PE=2 SV=2 23 257 2.0E-14
sp|Q5BJI7|SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio GN=smyd2a PE=2 SV=1 22 419 2.0E-14
sp|Q9CWR2|SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus GN=Smyd3 PE=2 SV=1 47 258 1.0E-12
sp|Q9H7B4|SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens GN=SMYD3 PE=1 SV=4 47 368 2.0E-12
sp|Q5ZIZ2|SMYD5_CHICK SET and MYND domain-containing protein 5 OS=Gallus gallus GN=SMYD5 PE=2 SV=1 155 257 2.0E-10
sp|Q6GMV2|SMYD5_HUMAN SET and MYND domain-containing protein 5 OS=Homo sapiens GN=SMYD5 PE=1 SV=2 155 257 8.0E-10
sp|Q3TYX3|SMYD5_MOUSE SET and MYND domain-containing protein 5 OS=Mus musculus GN=Smyd5 PE=1 SV=2 155 257 2.0E-09
sp|Q6GPQ4|SMYD5_XENLA SET and MYND domain-containing protein 5 OS=Xenopus laevis GN=smyd5 PE=2 SV=1 153 273 3.0E-08
sp|Q5PP37|ATXR2_ARATH Histone-lysine N-methyltransferase ATXR2 OS=Arabidopsis thaliana GN=ATXR2 PE=2 SV=1 180 257 9.0E-07
sp|A3M0J3|SET5_PICST Potential protein lysine methyltransferase SET5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SET5 PE=3 SV=2 175 303 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|100230
MDVTFKNIKLVPHPTARSQAISTKKISAGSVVVSVPAFTSALLEAEKGQRCDTCFRLPPDGEKLKKCTGCASYFY
CDIRCQKVQWDLEHKRQFSQHERMDVILLSHFLGRTLKTKPVSSADNSHDPFSIFLSLLPGSHASQRTLDSIPKS
LILDDSLVQDIYSRFGNNNFTIHSHLNSIGHGVFPLASRLFNHSCIPNAAPRYVQGPAQPVLMEVVALRDTDVGE
EICIPYLDPALTQSRSQIFQYTYGFTCQCSSCRDISQLGQIPKPPDSSETMSSLGDELREYVGVSDVLGAELPTP
SLSDLPLGLRCALHESYMEQLSEQFSKASHEGDYNTAFGSGLILLALYLLIYPTNYPQIGLHLLELAKTHWNALI
TMETSGVGAEIRSQVRIFLSHANRILRIYGKEGDEHGPLDELVKLDELLSADT*
Coding >Agabi119p4|100230
ATGGATGTCACATTCAAAAACATCAAACTTGTTCCACATCCTACCGCTCGGTCGCAGGCTATTTCCACTAAAAAA
ATATCTGCTGGATCAGTCGTGGTGTCAGTACCAGCCTTTACTTCCGCCTTACTTGAAGCCGAAAAGGGACAGAGA
TGTGATACCTGTTTTCGTTTACCACCTGACGGTGAAAAACTGAAGAAGTGCACCGGGTGTGCCTCGTATTTCTAC
TGTGATATCAGATGCCAGAAGGTACAATGGGACTTGGAGCATAAGCGCCAATTTTCACAACATGAGCGCATGGAT
GTCATACTCTTATCGCACTTCCTCGGGCGAACTCTGAAGACGAAACCCGTTTCATCGGCAGATAACTCTCACGAT
CCATTTTCAATATTCCTCTCGCTCCTTCCTGGTTCTCATGCATCCCAAAGAACACTAGACTCAATTCCGAAATCT
CTGATTCTTGATGACAGTCTTGTCCAAGATATCTATTCTCGCTTTGGCAACAATAATTTTACCATCCATTCGCAT
TTGAACTCTATCGGCCACGGTGTTTTCCCTCTGGCAAGCCGATTGTTCAATCATTCTTGCATTCCAAACGCCGCA
CCAAGATATGTGCAGGGCCCCGCTCAACCCGTTCTTATGGAGGTAGTTGCACTTCGTGACACCGACGTCGGGGAA
GAGATCTGTATTCCCTATCTGGATCCCGCCCTGACCCAGTCCCGGAGTCAAATTTTTCAATACACTTACGGATTT
ACTTGCCAATGCAGTTCTTGTAGGGATATAAGCCAACTGGGGCAGATACCAAAGCCACCGGACTCTTCAGAAACG
ATGTCGTCTCTCGGTGACGAGCTACGAGAGTACGTGGGGGTGTCTGATGTACTGGGCGCGGAACTTCCTACACCC
TCCCTTTCCGACCTTCCACTCGGGCTACGATGTGCATTGCACGAATCTTATATGGAACAGCTATCAGAACAATTC
AGCAAAGCCTCTCACGAGGGGGACTATAATACCGCTTTTGGAAGTGGTCTTATTTTGCTAGCCCTGTATCTCTTG
ATATATCCGACAAATTATCCACAGATCGGATTGCACCTCTTAGAATTGGCAAAGACACACTGGAATGCACTAATT
ACGATGGAAACCTCAGGCGTGGGGGCAGAGATCAGGAGTCAAGTGAGGATTTTCTTGAGCCATGCCAACAGAATA
TTGCGGATATATGGTAAAGAAGGAGATGAGCACGGTCCCCTTGATGAACTCGTGAAACTAGATGAGCTCTTGTCC
GCGGATACTTGA
Transcript >Agabi119p4|100230
ATGGATGTCACATTCAAAAACATCAAACTTGTTCCACATCCTACCGCTCGGTCGCAGGCTATTTCCACTAAAAAA
ATATCTGCTGGATCAGTCGTGGTGTCAGTACCAGCCTTTACTTCCGCCTTACTTGAAGCCGAAAAGGGACAGAGA
TGTGATACCTGTTTTCGTTTACCACCTGACGGTGAAAAACTGAAGAAGTGCACCGGGTGTGCCTCGTATTTCTAC
TGTGATATCAGATGCCAGAAGGTACAATGGGACTTGGAGCATAAGCGCCAATTTTCACAACATGAGCGCATGGAT
GTCATACTCTTATCGCACTTCCTCGGGCGAACTCTGAAGACGAAACCCGTTTCATCGGCAGATAACTCTCACGAT
CCATTTTCAATATTCCTCTCGCTCCTTCCTGGTTCTCATGCATCCCAAAGAACACTAGACTCAATTCCGAAATCT
CTGATTCTTGATGACAGTCTTGTCCAAGATATCTATTCTCGCTTTGGCAACAATAATTTTACCATCCATTCGCAT
TTGAACTCTATCGGCCACGGTGTTTTCCCTCTGGCAAGCCGATTGTTCAATCATTCTTGCATTCCAAACGCCGCA
CCAAGATATGTGCAGGGCCCCGCTCAACCCGTTCTTATGGAGGTAGTTGCACTTCGTGACACCGACGTCGGGGAA
GAGATCTGTATTCCCTATCTGGATCCCGCCCTGACCCAGTCCCGGAGTCAAATTTTTCAATACACTTACGGATTT
ACTTGCCAATGCAGTTCTTGTAGGGATATAAGCCAACTGGGGCAGATACCAAAGCCACCGGACTCTTCAGAAACG
ATGTCGTCTCTCGGTGACGAGCTACGAGAGTACGTGGGGGTGTCTGATGTACTGGGCGCGGAACTTCCTACACCC
TCCCTTTCCGACCTTCCACTCGGGCTACGATGTGCATTGCACGAATCTTATATGGAACAGCTATCAGAACAATTC
AGCAAAGCCTCTCACGAGGGGGACTATAATACCGCTTTTGGAAGTGGTCTTATTTTGCTAGCCCTGTATCTCTTG
ATATATCCGACAAATTATCCACAGATCGGATTGCACCTCTTAGAATTGGCAAAGACACACTGGAATGCACTAATT
ACGATGGAAACCTCAGGCGTGGGGGCAGAGATCAGGAGTCAAGTGAGGATTTTCTTGAGCCATGCCAACAGAATA
TTGCGGATATATGGTAAAGAAGGAGATGAGCACGGTCCCCTTGATGAACTCGTGAAACTAGATGAGCTCTTGTCC
GCGGATACTTGA
Gene >Agabi119p4|100230
ATGGATGTCACATTCAAAAACATCAAACTTGTTCCACATCCTACCGCTCGGTCGCAGGCTATTTCCACTAAAAAA
ATATCTGCTGGATCAGTCGTGGTGTCAGTACCAGCCTTTACTTCCGCCTTACTTGAAGCCGAAAAGGGACAGAGA
TGTGATACCTGTTTTCGTTTACCACCTGACGGTGAAAAACTGAAGAAGTGCACCGGGTGTGCCTCGTATTTCTAC
TGTGATATCAGATGTTAGGCCTTTATTGTTCTCAGTCAGCATACTATGCTGACTTTCGTATCCACAGGCCAGAAG
GTACAATGGGACTTGGAGCATAAGCGCGTATGTAAGAGTTATAGCCTGATGATATCCTACCTTCATGGCCAGCAA
TTTTCACAACATGAGCGCATGGATGTCATACTCTTATCGCACTTCCTCGGGCGAACTCTGAAGACGAAACCCGTT
TCATCGGCAGATAACTCTCACGATCCATTTTCAATATTCCTCTCGCTCCTTCCTGGTTCTCATGCATCCCAAAGA
ACACTAGACTCAATTCCGAAATCTCTGATTCTTGATGACAGTCTTGTCCAAGATATCTATTCTCGCTTTGGCAAC
AATAATTTTACCATCCATTCGCATTTGAACTCTATCGGCCACGGTGTTTTCCCTCTGGCAAGCCGATTGTTCAAT
CATTCTTGCATTCCAAACGCCGCACCAAGATATGTGCAGGGCCCCGCTCAACCCGTTCTTATGGAGGTAGTTGCA
CTTCGTGACACCGACGTCGGGGAAGAGGTCAGACAGGTCAGGTCTCGACCTTGCTAATACAAATTAACCTGTTTT
AAAGATCTGTATTCCCTATCTGGATCCCGCCCTGACCCAGTCCCGGAGTCAAATTTTTCAATACACTTACGGATT
TACTTGCCAATGCAGTTCTTGTAGGGATATAAGCCAACTGGGGCAGATACCAAAGCCACCGGACTCTTCAGAAAC
GATGTCGTCTCTCGGTGACGAGCTACGAGAGTACGTGGGGGTGTCTGATGTACTGGGCGCGGAACTTCCTACACC
CTCCCTTTCCGACCTTCCACTCGGGCTACGATGTGCATTGCACGAATCTTATATGGAACAGCTATCAGAACAATT
CAGCAAAGCCTCTCACGAGGGGGACTATAATACCGCTTTTGGAAGTGGTCTTATTTTGCTAGCCCTGTATCTCTT
GATATATCCGACAAATTATCCACAGATCGGTGAGTTATATCTACCTCAGATCATATTCTATGCGGCGGATGAACA
ATAATTTTAGGATTGCACCTCTTAGAATTGGCAAAGACACACTGGAATGCACTAATTACGATGGAAACCTCAGGC
GTGGGGGCAGAGATCAGGAGTCAAGTGAGGATTTTCTTGAGCCATGCCAACAGAATATTGCGGATATATGGTAAA
GAAGGAGATGAGCACGGTCCCCTTGATGAACTCGTGAAACTAGATGAGCTCTTGTCCGCGGATACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail