Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|100040
Gene name
Locationscaffold_07:719683..721077
Strand+
Gene length (bp)1394
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.2E-11 54 135
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.1E-17 257 371
PF00106 adh_short short chain dehydrogenase 1.5E-17 47 135
PF00106 adh_short short chain dehydrogenase 2.0E-07 256 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 40 371 1.0E-16
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 39 371 2.0E-13
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 39 376 5.0E-12
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 39 376 5.0E-12
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 43 134 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 40 371 1.0E-16
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 39 371 2.0E-13
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 39 376 5.0E-12
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 39 376 5.0E-12
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 43 134 1.0E-11
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 46 374 3.0E-11
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 46 374 3.0E-11
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 276 371 3.0E-11
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 276 371 3.0E-11
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 40 371 4.0E-11
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 42 371 5.0E-11
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 255 373 7.0E-11
sp|Q9LTV6|DECR2_ARATH Peroxisomal 2,4-dienoyl-CoA reductase OS=Arabidopsis thaliana GN=At3g12800 PE=2 SV=1 35 126 8.0E-11
sp|P50842|KDUD_BACSU 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) GN=kduD PE=2 SV=1 258 371 9.0E-11
sp|P05406|FIXR_BRADU Protein FixR OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixR PE=3 SV=2 256 372 1.0E-10
sp|Q05528|KDUD_DICD3 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 255 374 1.0E-10
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 279 373 1.0E-10
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 255 371 2.0E-10
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 42 371 2.0E-10
sp|O93868|MTDH_AGABI NADP-dependent mannitol dehydrogenase OS=Agaricus bisporus GN=mtdH PE=1 SV=3 256 373 2.0E-10
sp|P37769|KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 255 374 8.0E-10
sp|P50200|HDHA_CLOSO NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 259 380 9.0E-10
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 253 373 9.0E-10
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 276 371 2.0E-09
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 276 371 2.0E-09
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 276 371 2.0E-09
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 276 371 2.0E-09
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 276 371 2.0E-09
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 276 371 2.0E-09
sp|P9WGT3|FABG_MYCTU 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG1 PE=1 SV=1 278 371 4.0E-09
sp|P9WGT2|FABG_MYCTO 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG1 PE=3 SV=1 278 371 4.0E-09
sp|P0A5Y5|FABG_MYCBO 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG PE=3 SV=1 278 371 4.0E-09
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 276 371 5.0E-09
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 255 371 1.0E-08
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 255 371 1.0E-08
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 251 373 1.0E-08
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 278 371 2.0E-08
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 46 129 2.0E-08
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 46 129 2.0E-08
sp|P50166|ARDH_CANTR D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida tropicalis GN=ARD PE=1 SV=1 279 371 2.0E-08
sp|Q10216|YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.08 PE=3 SV=1 12 373 2.0E-08
sp|P43066|ARDH_CANAW D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida albicans (strain WO-1) GN=ARD1 PE=3 SV=1 279 371 2.0E-08
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 258 371 2.0E-08
sp|Q9URX0|YLX6_SCHPO Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.06 PE=3 SV=1 276 375 3.0E-08
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 279 374 3.0E-08
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 46 129 3.0E-08
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 46 129 3.0E-08
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 46 129 3.0E-08
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 44 132 3.0E-08
sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 46 373 4.0E-08
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 279 379 4.0E-08
sp|P32573|SPS19_YEAST Peroxisomal 2,4-dienoyl-CoA reductase SPS19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS19 PE=1 SV=4 282 371 4.0E-08
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 255 371 5.0E-08
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 255 370 5.0E-08
sp|A3LZU7|RM1DH_PICST L-rhamnose-1-dehydrogenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHG2 PE=1 SV=2 279 376 7.0E-08
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 276 373 8.0E-08
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 276 373 8.0E-08
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 278 371 8.0E-08
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 251 371 9.0E-08
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 251 371 9.0E-08
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 278 371 9.0E-08
sp|P27582|FABG6_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase (Fragments) OS=Brassica napus PE=1 SV=3 255 371 9.0E-08
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 278 371 1.0E-07
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 276 371 1.0E-07
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 37 133 1.0E-07
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 278 371 1.0E-07
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 46 129 2.0E-07
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 46 129 2.0E-07
sp|P57432|FABG_BUCAI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabG PE=3 SV=1 278 371 2.0E-07
sp|P50167|ARDH_PICST D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARDH PE=2 SV=1 279 371 2.0E-07
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 277 371 2.0E-07
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 258 371 2.0E-07
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 46 129 2.0E-07
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 42 133 2.0E-07
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 46 132 2.0E-07
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 279 371 2.0E-07
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 279 371 2.0E-07
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 253 373 2.0E-07
sp|P44481|Y048_HAEIN Uncharacterized oxidoreductase HI_0048 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0048 PE=1 SV=1 255 371 3.0E-07
sp|Q56841|HCDS_XANP2 2-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecE PE=1 SV=1 277 374 3.0E-07
sp|Q9ZW14|TRNH8_ARATH Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1 279 371 3.0E-07
sp|Q3U0B3|DHR11_MOUSE Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 46 132 4.0E-07
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 278 371 4.0E-07
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 277 371 5.0E-07
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 277 371 5.0E-07
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 39 130 5.0E-07
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 46 132 6.0E-07
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 18 149 6.0E-07
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 278 371 6.0E-07
sp|Q99L04|DHRS1_MOUSE Dehydrogenase/reductase SDR family member 1 OS=Mus musculus GN=Dhrs1 PE=1 SV=1 42 128 6.0E-07
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 41 130 6.0E-07
sp|Q9ZW15|TRNH9_ARATH Tropinone reductase homolog At2g29320 OS=Arabidopsis thaliana GN=At2g29320 PE=2 SV=1 279 379 7.0E-07
sp|O34896|UXUB_BACSU Uncharacterized oxidoreductase UxuB OS=Bacillus subtilis (strain 168) GN=uxuB PE=2 SV=1 259 374 8.0E-07
sp|O32185|YUSS_BACSU Short-chain dehydrogenase/reductase homolog YusS OS=Bacillus subtilis (strain 168) GN=yusS PE=5 SV=1 41 133 8.0E-07
sp|P0C0Y4|MTDH_ALTAL Probable NADP-dependent mannitol dehydrogenase OS=Alternaria alternata PE=1 SV=2 252 371 8.0E-07
sp|Q42182|TRNH7_ARATH Tropinone reductase homolog At2g29300 OS=Arabidopsis thaliana GN=At2g29300 PE=2 SV=2 279 379 9.0E-07
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 46 371 9.0E-07
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 41 130 9.0E-07
sp|Q96LJ7|DHRS1_HUMAN Dehydrogenase/reductase SDR family member 1 OS=Homo sapiens GN=DHRS1 PE=1 SV=1 42 128 1.0E-06
sp|Q8NK50|MTDH_HYPJE NADP-dependent mannitol dehydrogenase OS=Hypocrea jecorina GN=lxr1 PE=1 SV=1 255 371 1.0E-06
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 39 129 1.0E-06
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 39 129 1.0E-06
sp|O74470|YQC8_SCHPO Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 278 371 1.0E-06
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 257 371 2.0E-06
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 288 377 2.0E-06
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 288 377 2.0E-06
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 41 129 2.0E-06
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 42 130 2.0E-06
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 42 130 2.0E-06
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 259 371 2.0E-06
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 279 371 3.0E-06
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 278 373 3.0E-06
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 176 371 3.0E-06
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 46 149 3.0E-06
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 41 132 3.0E-06
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 46 149 3.0E-06
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 46 149 3.0E-06
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 37 133 4.0E-06
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 279 374 4.0E-06
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 278 374 4.0E-06
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 278 371 5.0E-06
sp|P50203|PHAB_ACISR Acetoacetyl-CoA reductase OS=Acinetobacter sp. (strain RA3849) GN=phaB PE=3 SV=1 256 371 6.0E-06
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 277 374 7.0E-06
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 37 132 8.0E-06
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 277 374 8.0E-06
sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 279 374 8.0E-06
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 259 371 8.0E-06
sp|P9WGQ5|Y927C_MYCTU Uncharacterized oxidoreductase Rv0927c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0927c PE=1 SV=1 259 371 8.0E-06
sp|P9WGQ4|Y927C_MYCTO Uncharacterized oxidoreductase MT0954 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0954 PE=3 SV=1 259 371 8.0E-06
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 279 371 9.0E-06
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 251 371 1.0E-05
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 41 131 1.0E-05
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 46 145 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|100040
MASKCPSSFESKDSLLDPDPVASGSCPSTSNFRFNPMRLFNVEGLITVITGGGSGIGLIMATALENNGATVYIVG
RRRQVLVKAAAENSRFGKIIPLEGDITSKESLLSIVEVVKARHGYIDLLINNAGVARNFYQHPLPTPATSSSLDP
PSPPSSPMPNYEKSAPSIKAFQKALWDIGTMEEWEESFRTNSIAVYYTTVAFLELLHRGNVRKLRLERGPSPAIS
RSNSGTDTPSDSIPASGIATGESFGGRPYHSSQVISVSSSGGFRTDHKVLSPSYTLSKAACTHLGKLMANLLASW
GIRSNVLAPGVWPTDMTTQPTPDITLSPSQLASVVPLKRVGTDEDMAGTILYMASPAGAYVDGSVWLVDGGRVAG
LTSQY*
Coding >Agabi119p4|100040
ATGGCTTCGAAGTGTCCTTCGTCGTTTGAATCGAAGGATAGTTTGCTGGATCCAGATCCCGTAGCTTCCGGATCT
TGTCCTTCGACGTCGAATTTCAGGTTTAATCCTATGAGGCTCTTCAACGTAGAGGGACTTATAACAGTAATAACC
GGTGGAGGAAGTGGAATTGGGCTAATAATGGCTACTGCCCTTGAAAACAATGGTGCTACTGTATACATTGTAGGA
CGGAGGCGCCAAGTGTTGGTAAAAGCAGCGGCGGAAAACAGTAGGTTTGGCAAAATCATCCCTTTGGAAGGGGAC
ATCACCAGCAAGGAAAGCCTGCTCTCCATTGTCGAGGTTGTGAAAGCTAGACACGGGTATATCGACCTACTCATA
AACAATGCGGGGGTTGCTCGAAACTTCTACCAGCATCCCCTCCCGACCCCAGCCACATCTTCTTCGCTAGATCCG
CCCTCCCCGCCATCGTCCCCCATGCCCAACTATGAGAAGTCAGCACCCAGCATTAAAGCGTTCCAAAAGGCGTTG
TGGGATATTGGAACGATGGAGGAATGGGAAGAATCTTTCAGGACAAATTCTATCGCGGTTTACTACACAACCGTT
GCGTTCCTGGAGCTTCTGCATCGGGGGAATGTCAGAAAGCTAAGACTCGAGCGCGGCCCCTCGCCGGCAATATCA
AGATCTAATTCCGGTACGGACACGCCATCTGATTCAATACCGGCATCGGGAATAGCTACGGGAGAGTCATTCGGG
GGTCGTCCATATCACTCATCGCAGGTGATATCTGTCTCGAGTAGTGGGGGATTCAGGACGGATCATAAGGTGCTT
TCCCCTTCTTACACACTCTCCAAAGCTGCTTGCACCCATCTGGGGAAGCTCATGGCGAACCTGCTAGCTTCGTGG
GGCATCAGGAGCAATGTTTTAGCACCAGGTGTTTGGCCGACTGATATGACTACTCAACCGACACCCGATATAACT
TTGAGCCCTTCACAACTTGCTAGTGTCGTTCCTCTCAAAAGGGTCGGAACTGACGAAGATATGGCCGGAACCATC
CTATACATGGCGAGCCCTGCAGGAGCCTATGTGGATGGATCTGTTTGGCTAGTGGACGGTGGCCGCGTGGCCGGT
TTAACAAGCCAATACTAA
Transcript >Agabi119p4|100040
ATGGCTTCGAAGTGTCCTTCGTCGTTTGAATCGAAGGATAGTTTGCTGGATCCAGATCCCGTAGCTTCCGGATCT
TGTCCTTCGACGTCGAATTTCAGGTTTAATCCTATGAGGCTCTTCAACGTAGAGGGACTTATAACAGTAATAACC
GGTGGAGGAAGTGGAATTGGGCTAATAATGGCTACTGCCCTTGAAAACAATGGTGCTACTGTATACATTGTAGGA
CGGAGGCGCCAAGTGTTGGTAAAAGCAGCGGCGGAAAACAGTAGGTTTGGCAAAATCATCCCTTTGGAAGGGGAC
ATCACCAGCAAGGAAAGCCTGCTCTCCATTGTCGAGGTTGTGAAAGCTAGACACGGGTATATCGACCTACTCATA
AACAATGCGGGGGTTGCTCGAAACTTCTACCAGCATCCCCTCCCGACCCCAGCCACATCTTCTTCGCTAGATCCG
CCCTCCCCGCCATCGTCCCCCATGCCCAACTATGAGAAGTCAGCACCCAGCATTAAAGCGTTCCAAAAGGCGTTG
TGGGATATTGGAACGATGGAGGAATGGGAAGAATCTTTCAGGACAAATTCTATCGCGGTTTACTACACAACCGTT
GCGTTCCTGGAGCTTCTGCATCGGGGGAATGTCAGAAAGCTAAGACTCGAGCGCGGCCCCTCGCCGGCAATATCA
AGATCTAATTCCGGTACGGACACGCCATCTGATTCAATACCGGCATCGGGAATAGCTACGGGAGAGTCATTCGGG
GGTCGTCCATATCACTCATCGCAGGTGATATCTGTCTCGAGTAGTGGGGGATTCAGGACGGATCATAAGGTGCTT
TCCCCTTCTTACACACTCTCCAAAGCTGCTTGCACCCATCTGGGGAAGCTCATGGCGAACCTGCTAGCTTCGTGG
GGCATCAGGAGCAATGTTTTAGCACCAGGTGTTTGGCCGACTGATATGACTACTCAACCGACACCCGATATAACT
TTGAGCCCTTCACAACTTGCTAGTGTCGTTCCTCTCAAAAGGGTCGGAACTGACGAAGATATGGCCGGAACCATC
CTATACATGGCGAGCCCTGCAGGAGCCTATGTGGATGGATCTGTTTGGCTAGTGGACGGTGGCCGCGTGGCCGGT
TTAACAAGCCAATACTAA
Gene >Agabi119p4|100040
ATGGCTTCGAAGTGTCCTTCGTCGTTTGAATCGAAGGATAGTTTGCTGGATCCAGATCCCGTAGCTTCCGGATCT
TGTCCTTCGACGTCGAATTTCAGGTTTAATCCTATGAGGCTCTTCAACGTAGAGGGACTTATAACAGTAATAACC
GGTGGAGGAAGTGGTAAGTAATCTTCCTACGATGTGATCGCAGTCTTGCAGTGGCGGAATTCTGAACAGAATTGA
TGACTATACTACTTATAGGAATTGGGCTAATAATGGCTACTGCCCTTGAAAACAATGGTGCTACTGTATACATTG
TAGGACGGAGGCGCCAAGTGTTGGTAAAAGCAGCGGCGGAAAACAGTGTACGCAATCACTTTTGTTCTTGGCAAT
CGCCATGTCTAGAGATGACCTCACACCATCCAGAGGTTTGGCAAAATCATCCCTTTGGAAGGGGACATCACCAGC
AAGGAAAGCCTGCTCTCCATTGTCGAGGTTGTGAAAGCTAGACACGGGTATATCGACCTACTCATAAACAATGCG
GGGGTTGCTCGAAACTTCTACCAGCATCCCCTCCCGACCCCAGCCACATCTTCTTCGCTAGATCCGCCCTCCCCG
CCATCGTCCCCCATGCCCAACTATGAGAAGTCAGCACCCAGCATTAAAGCGTTCCAAAAGGCGTTGTGGGATATT
GGAACGATGGAGGAATGGGAAGAATCTTTCAGGACAAATTCTATCGCGGTTTACTACACAACCGTTGCGTTCCTG
GAGCTTCTGCATCGGGGGAATGTCAGAAAGCTAAGACTCGAGCGCGGCCCCTCGCCGGCAATATCAAGATCTAAT
TCCGGTACGGACACGCCATCTGATTCAATACCGGCATCGGGAATAGCTACGGGAGAGTCATTCGGGGGTCGTCCA
TATCACTCATCGCAGGTGATATCTGTCTCGAGTAGTGGGGGATTCAGGACGGATCATAAGGTGCTTTCCCCTTCT
TACACACTCTCCAAAGCTGCTTGCACCCATCTGGGGAAGCTCATGGCGAACCTGCTAGCTTCGTGGGGCATCAGG
AGCAATGTTTTAGCACCAGGTGTTTGGCCGACTGGTGAGTTTATCTTGAATTTCTTTTCTTTTCAGTCGAGCTTC
TTGTTGATAGTTATCGCATAGATATGACTACTCAACCGACACCCGATATAACTTTGAGCCCTTCACAACTTGCTA
GTGTCGTTCCTCTCAAAAGGGTCGGAACTGACGAAGTAGGTTTCATTGGTTTCTAACTACAGTACTTTCTAACTC
TTAATCAGGATATGGCCGGAACCATCCTATACATGGCGAGCCCTGCAGGAGCCTATGTGGATGGATCTGTTTGGC
TAGTGGACGGTGGCCGCGTGGCCGGTTTAACAAGCCAATACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail