Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|100000
Gene name
Locationscaffold_07:704362..706434
Strand+
Gene length (bp)2072
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07647 SAM_2 SAM domain (Sterile alpha motif) 2.1E-07 550 607

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P965|VTS1_USTMA Protein VTS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VTS1 PE=3 SV=1 11 314 3.0E-66
sp|Q5BGC4|VTS1_EMENI Protein vts1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vts1 PE=3 SV=1 29 299 3.0E-37
sp|Q4WJS2|VTS1_ASPFU Protein vts1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vts1 PE=3 SV=2 29 155 1.0E-36
sp|Q7RZQ3|VTS1_NEUCR Protein VTS1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vts1 PE=3 SV=3 30 299 9.0E-36
sp|Q6CHK0|VTS1_YARLI Protein VTS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VTS1 PE=3 SV=1 60 134 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P965|VTS1_USTMA Protein VTS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VTS1 PE=3 SV=1 11 314 3.0E-66
sp|Q5BGC4|VTS1_EMENI Protein vts1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vts1 PE=3 SV=1 29 299 3.0E-37
sp|Q4WJS2|VTS1_ASPFU Protein vts1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vts1 PE=3 SV=2 29 155 1.0E-36
sp|Q7RZQ3|VTS1_NEUCR Protein VTS1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vts1 PE=3 SV=3 30 299 9.0E-36
sp|Q6CHK0|VTS1_YARLI Protein VTS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VTS1 PE=3 SV=1 60 134 2.0E-23
sp|Q7RZQ3|VTS1_NEUCR Protein VTS1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vts1 PE=3 SV=3 543 609 8.0E-21
sp|Q4IBN1|VTS1_GIBZE Protein VTS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VTS1 PE=3 SV=1 543 608 1.0E-20
sp|Q6CHK0|VTS1_YARLI Protein VTS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VTS1 PE=3 SV=1 546 608 6.0E-20
sp|Q4WJS2|VTS1_ASPFU Protein vts1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vts1 PE=3 SV=2 543 608 2.0E-18
sp|Q5BGC4|VTS1_EMENI Protein vts1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vts1 PE=3 SV=1 543 608 4.0E-18
sp|Q758Y4|VTS1_ASHGO Protein VTS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VTS1 PE=3 SV=2 546 609 2.0E-17
sp|Q5AI80|VTS1_CANAL Protein VTS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VTS1 PE=3 SV=1 550 611 5.0E-17
sp|Q6BSL1|VTS1_DEBHA Protein VTS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VTS1 PE=3 SV=2 547 609 3.0E-16
sp|Q6CY29|VTS1_KLULA Protein VTS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VTS1 PE=3 SV=1 510 609 5.0E-16
sp|Q6FM94|VTS1_CANGA Protein VTS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VTS1 PE=3 SV=1 546 608 9.0E-16
sp|Q08831|VTS1_YEAST Protein VTS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTS1 PE=1 SV=1 546 607 2.0E-15
sp|Q9P6R7|VTS1_SCHPO Protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13E7.03c PE=1 SV=1 508 607 7.0E-14
sp|B5DF21|SMAG1_RAT Protein Smaug homolog 1 OS=Rattus norvegicus GN=Samd4a PE=1 SV=1 551 613 4.0E-07
sp|Q0IHW3|SMAG1_XENTR Protein Smaug homolog 1 OS=Xenopus tropicalis GN=samd4a PE=2 SV=1 551 613 5.0E-07
sp|Q8CBY1|SMAG1_MOUSE Protein Smaug homolog 1 OS=Mus musculus GN=Samd4a PE=1 SV=2 551 613 6.0E-07
sp|Q9UPU9|SMAG1_HUMAN Protein Smaug homolog 1 OS=Homo sapiens GN=SAMD4A PE=1 SV=3 551 613 6.0E-07
sp|Q95LV5|SMAG1_MACFA Protein Smaug homolog 1 OS=Macaca fascicularis GN=SAMD4A PE=2 SV=2 551 613 7.0E-07
sp|Q80XS6|SMAG2_MOUSE Protein Smaug homolog 2 OS=Mus musculus GN=Samd4b PE=2 SV=1 551 613 3.0E-06
sp|Q5FWP2|SMAG1_XENLA Protein Smaug homolog 1 OS=Xenopus laevis GN=samd4a PE=2 SV=1 551 613 4.0E-06
sp|Q5PRF9|SMAG2_HUMAN Protein Smaug homolog 2 OS=Homo sapiens GN=SAMD4B PE=1 SV=1 551 613 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|100000
MLSPSPDSAKAVARQSLGRATPTLVPASPRPASHSNTRPTSELPLGSAGIFQTPEAEALDQWFENLQNYEATLEE
MAAASLDVDFKEELGAIEQWFKVLSEAERTAALYSLLQHSTQVQIRFFITVLQQMARSDPMTALLSPAMGSMQNQ
MEASLARIKSPGLKSNMPASPTTRNFNPNRQSLIFDNFLSPDSAATNAASDAAATLAQQRARLKNAEHRISAPVL
ASAAANGRASWAPTSSLPQVSEASAPAQEILIGASRPKSGDFSGTSPSPRLSGGSPNEGQSWASMVNTPAIPLFP
KNTRAADSANTQLNEWNQTSGPGVPRMGDPTVYRKKPVSGDKQNENGNHQHYDDNGNLVNQDARGRRNASGGWGG
RSQAPPTMNSNPANNRFNNNGDEANGMNGLGMQLGGLHLGMGSPQMHGMPPAAAAAALANMAGPMSPFNMNMLSA
IALSPEAQLLAAQVAAANAQGYGHPGWLGMPSMSAGVNPHGGGSAVGGNNNRRGGGNPPSGRSTTGFRSAAPSVG
SNAIANINNNNNNTPKGEEEVDPALLNDIPAWLRSLRLHKYTPNFEGMRWQDIVVMDEGELEGKGVAALGARRKM
LKTFEVVRRKMGMEGVSGETGNANGV*
Coding >Agabi119p4|100000
ATGCTCAGTCCGTCCCCTGACTCTGCAAAGGCCGTCGCTCGCCAGTCCCTGGGCCGTGCAACCCCCACCCTCGTC
CCAGCCTCGCCACGCCCAGCATCCCACTCCAACACCAGACCCACCAGCGAGCTCCCCCTCGGCAGCGCAGGCATC
TTCCAGACCCCAGAAGCCGAGGCCCTCGACCAGTGGTTTGAAAATTTGCAAAATTATGAAGCTACCCTCGAGGAA
ATGGCCGCCGCCTCTCTCGATGTCGACTTCAAAGAGGAGCTCGGCGCCATCGAGCAATGGTTTAAAGTTCTCTCA
GAAGCAGAGCGCACAGCCGCTCTTTACAGTCTTCTCCAGCATTCTACCCAAGTTCAGATTCGTTTTTTCATCACC
GTCCTCCAGCAGATGGCCCGTTCAGACCCAATGACCGCCCTTCTCAGCCCTGCCATGGGATCAATGCAAAACCAA
ATGGAAGCCAGCCTTGCTCGGATCAAGTCCCCTGGCCTCAAATCCAATATGCCCGCCTCTCCCACCACCCGCAAT
TTCAACCCCAACCGCCAATCCCTCATCTTTGACAACTTTCTCTCTCCCGATTCCGCTGCCACAAATGCCGCATCA
GATGCCGCCGCTACCCTCGCACAACAGCGTGCCAGGTTGAAAAACGCCGAGCACCGCATCTCGGCTCCTGTTTTG
GCATCCGCCGCCGCCAATGGTCGCGCGTCTTGGGCTCCTACCTCCTCCCTCCCTCAGGTTTCAGAGGCGAGCGCC
CCCGCCCAGGAAATTCTCATCGGCGCTTCTCGCCCCAAGAGCGGTGACTTTTCTGGTACTTCGCCCTCACCTCGC
CTCAGCGGAGGTTCTCCCAACGAAGGTCAAAGCTGGGCCAGCATGGTCAACACCCCTGCCATCCCCCTCTTCCCC
AAGAACACCCGAGCTGCAGATTCCGCCAATACACAGTTGAACGAGTGGAACCAGACTTCTGGACCTGGCGTCCCA
CGTATGGGTGATCCTACCGTTTATCGCAAGAAACCCGTTTCGGGCGATAAACAAAATGAAAATGGTAACCATCAA
CATTATGATGATAACGGTAATTTGGTCAATCAAGACGCTCGTGGTCGTCGAAATGCCAGTGGAGGTTGGGGTGGT
AGGAGCCAGGCGCCTCCTACCATGAACTCCAACCCAGCCAACAATCGCTTCAACAACAACGGTGATGAAGCAAAC
GGTATGAACGGTCTTGGTATGCAGCTGGGTGGACTTCATCTGGGTATGGGGTCACCACAAATGCATGGTATGCCA
CCGGCTGCTGCTGCTGCTGCATTGGCGAATATGGCTGGACCGATGAGTCCATTCAATATGAATATGTTGAGTGCT
ATAGCACTCTCACCTGAAGCTCAGCTGCTTGCGGCACAAGTGGCGGCTGCGAACGCTCAAGGTTACGGACATCCA
GGATGGTTGGGTATGCCATCGATGTCTGCTGGAGTTAACCCACATGGCGGTGGATCAGCTGTGGGTGGGAATAAT
AATCGACGTGGAGGAGGAAATCCACCTTCGGGTCGATCTACCACTGGATTCCGAAGTGCTGCTCCTAGTGTGGGG
TCCAATGCGATAGCCAACATCAATAATAATAATAATAATACGCCGAAGGGAGAAGAAGAGGTGGATCCGGCGTTG
TTGAATGATATACCTGCGTGGTTGAGGAGTTTGAGGTTGCATAAGTATACACCGAATTTTGAAGGGATGAGGTGG
CAGGATATTGTGGTTATGGATGAGGGGGAGTTGGAGGGGAAGGGGGTTGCGGCGTTGGGGGCGAGGAGGAAGATG
TTGAAGACGTTTGAGGTTGTGAGGAGGAAGATGGGGATGGAGGGTGTATCGGGTGAGACTGGGAATGCGAATGGG
GTTTGA
Transcript >Agabi119p4|100000
ATGCTCAGTCCGTCCCCTGACTCTGCAAAGGCCGTCGCTCGCCAGTCCCTGGGCCGTGCAACCCCCACCCTCGTC
CCAGCCTCGCCACGCCCAGCATCCCACTCCAACACCAGACCCACCAGCGAGCTCCCCCTCGGCAGCGCAGGCATC
TTCCAGACCCCAGAAGCCGAGGCCCTCGACCAGTGGTTTGAAAATTTGCAAAATTATGAAGCTACCCTCGAGGAA
ATGGCCGCCGCCTCTCTCGATGTCGACTTCAAAGAGGAGCTCGGCGCCATCGAGCAATGGTTTAAAGTTCTCTCA
GAAGCAGAGCGCACAGCCGCTCTTTACAGTCTTCTCCAGCATTCTACCCAAGTTCAGATTCGTTTTTTCATCACC
GTCCTCCAGCAGATGGCCCGTTCAGACCCAATGACCGCCCTTCTCAGCCCTGCCATGGGATCAATGCAAAACCAA
ATGGAAGCCAGCCTTGCTCGGATCAAGTCCCCTGGCCTCAAATCCAATATGCCCGCCTCTCCCACCACCCGCAAT
TTCAACCCCAACCGCCAATCCCTCATCTTTGACAACTTTCTCTCTCCCGATTCCGCTGCCACAAATGCCGCATCA
GATGCCGCCGCTACCCTCGCACAACAGCGTGCCAGGTTGAAAAACGCCGAGCACCGCATCTCGGCTCCTGTTTTG
GCATCCGCCGCCGCCAATGGTCGCGCGTCTTGGGCTCCTACCTCCTCCCTCCCTCAGGTTTCAGAGGCGAGCGCC
CCCGCCCAGGAAATTCTCATCGGCGCTTCTCGCCCCAAGAGCGGTGACTTTTCTGGTACTTCGCCCTCACCTCGC
CTCAGCGGAGGTTCTCCCAACGAAGGTCAAAGCTGGGCCAGCATGGTCAACACCCCTGCCATCCCCCTCTTCCCC
AAGAACACCCGAGCTGCAGATTCCGCCAATACACAGTTGAACGAGTGGAACCAGACTTCTGGACCTGGCGTCCCA
CGTATGGGTGATCCTACCGTTTATCGCAAGAAACCCGTTTCGGGCGATAAACAAAATGAAAATGGTAACCATCAA
CATTATGATGATAACGGTAATTTGGTCAATCAAGACGCTCGTGGTCGTCGAAATGCCAGTGGAGGTTGGGGTGGT
AGGAGCCAGGCGCCTCCTACCATGAACTCCAACCCAGCCAACAATCGCTTCAACAACAACGGTGATGAAGCAAAC
GGTATGAACGGTCTTGGTATGCAGCTGGGTGGACTTCATCTGGGTATGGGGTCACCACAAATGCATGGTATGCCA
CCGGCTGCTGCTGCTGCTGCATTGGCGAATATGGCTGGACCGATGAGTCCATTCAATATGAATATGTTGAGTGCT
ATAGCACTCTCACCTGAAGCTCAGCTGCTTGCGGCACAAGTGGCGGCTGCGAACGCTCAAGGTTACGGACATCCA
GGATGGTTGGGTATGCCATCGATGTCTGCTGGAGTTAACCCACATGGCGGTGGATCAGCTGTGGGTGGGAATAAT
AATCGACGTGGAGGAGGAAATCCACCTTCGGGTCGATCTACCACTGGATTCCGAAGTGCTGCTCCTAGTGTGGGG
TCCAATGCGATAGCCAACATCAATAATAATAATAATAATACGCCGAAGGGAGAAGAAGAGGTGGATCCGGCGTTG
TTGAATGATATACCTGCGTGGTTGAGGAGTTTGAGGTTGCATAAGTATACACCGAATTTTGAAGGGATGAGGTGG
CAGGATATTGTGGTTATGGATGAGGGGGAGTTGGAGGGGAAGGGGGTTGCGGCGTTGGGGGCGAGGAGGAAGATG
TTGAAGACGTTTGAGGTTGTGAGGAGGAAGATGGGGATGGAGGGTGTATCGGGTGAGACTGGGAATGCGAATGGG
GTTTGA
Gene >Agabi119p4|100000
ATGCTCAGTCCGTCCCCTGACTCTGCAAAGGCCGTCGCTCGCCAGTCCCTGGGCCGTGCAACCCCCACCCTCGTC
CCAGCCTCGCCACGCCCAGCATCCCACTCCAACACCAGACCCACCAGCGAGCTCCCCCTCGGCAGCGCAGGCATC
TTCCAGACCCCAGAAGGTATGTGGCGATTTTATCATTCTTATCTTTCTCACCGTCCATTCAGCCGAGGCCCTCGA
CCAGTGGTTTGAAAATTTGCAAAATTATGAAGCTACCCTCGTACGTCTCTCACAATTTTCACTTTCCGCCGCTCA
CACGCCCCCCAGGAGGAAATGGCCGCCGCCTCTCTCGATGTCGACTTCAAAGAGGAGCTCGGCGCCATCGAGCAA
TGTACGTCGTCTTCCCCTCACCCCTTCTGTCCTAACATCCCCCACAGGGTTTAAAGTTCTCTCAGAAGCAGAGCG
CACAGCCGCTCTTTACAGTCTTCTCCAGCATTCTACCCAAGTTCAGATTCGTTTTTTCATCACCGTCCTCCAGCA
GATGGCCCGTTCAGACCCAATGACCGCCCTTCTCAGCCCTGCCATGGGTAAGCATCACCCACATCAATCCCATCA
CCCCTAACCACCGCCCTCACACAGGATCAATGCAAAACCAAATGGAAGCCAGCCTTGCTCGGATCAAGTCCCCTG
GCCTCAAATCCAATATGCCCGCCTCTCCCACCACCCGCAATTTCAACCCCAACCGCCAATCCCTCATCTTTGACA
ACTTTCTCTCTCCCGATTCCGCTGCCACAAATGCCGCATCAGATGCCGCCGCTACCCTCGCACAACAGCGTGCCA
GGTTGAAAAACGCCGAGCACCGCATCTCGGCTCCTGTTTTGGCATCCGCCGCCGCCAATGGTCGCGCGTCTTGGG
CTCCTACCTCCTCCCTCCCTCAGGTTTCAGAGGCGAGCGCCCCCGCCCAGGAAATTCTCATCGGCGCTTCTCGCC
CCAAGAGCGGTGACTTTTCTGGTACTTCGCCCTCACCTCGCCTCAGCGGAGGTTCTCCCAACGAAGGTCAAAGCT
GGGCCAGCATGGTCAACACCCCTGCCATCCCCCTCTTCCCCAAGAACACCCGAGCTGCAGATTCCGCCAATACAC
AGTTGAACGAGTGGAACCAGACTTCTGGACCTGGCGTCCCACGTATGGGTGATCCTACCGTTTATCGCAAGAAAC
CCGTTTCGGGCGATAAACAAAATGAAAATGGTAACCATCAACATTATGATGATAACGGTAATTTGGTCAATCAAG
ACGCTCGTGGTCGTCGAAATGCCAGTGGAGGTTGGGGTGGTAGGAGCCAGGCGCCTCCTACCATGAACTCCAACC
CAGCCAACAATCGCTTCAACAACAACGGTGATGAAGCAAACGGTATGAACGGTCTTGGTATGCAGCTGGGTGGAC
TTCATCTGGGTATGGGGTCACCACAAATGCATGGTATGCCACCGGCTGCTGCTGCTGCTGCATTGGCGAATATGG
CTGGACCGATGAGTCCATTCAATATGAATATGTTGAGTGCTATAGCACTCTCACCTGAAGCTCAGCTGCTTGCGG
CACAAGTGGCGGCTGCGAACGCTCAAGGTTACGGACATCCAGGATGGTTGGGTATGCCATCGATGTCTGCTGGAG
TTAACCCACATGGCGGTGGATCAGCTGTGGGTGGGAATAATAATCGACGTGGAGGAGGAAATCCACCTTCGGGTC
GATCTACCACTGGATTCCGAAGTGCTGCTCCTAGTGTGGGGTCCAATGCGATAGCCAACATCAATAATAATAATA
ATAATACGCCGAAGGGAGAAGAAGAGGTGGATCCGGCGTTGTTGAATGATATACCTGCGTGGTTGAGGAGTTTGA
GGTTGCATAAGTATACACCGAATTTTGAAGGGATGAGGTGGCAGGATATTGTGGTTATGGATGAGGGGGAGTTGG
AGGGGAAGGGGGTTGCGGCGTTGGGGGCGAGGAGGAAGATGTTGAAGACGTTTGAGGTTGTGAGGAGGAAGATGG
GGATGGAGGGTGTATCGGGTGAGACTGGGAATGCGAATGGGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail