Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|099650
Gene name
Locationscaffold_07:636019..638142
Strand+
Gene length (bp)2123
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 3.5E-92 180 512
PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like 1.4E-20 20 157
PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2 2.4E-09 18 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SYK0|HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana GN=HEXO2 PE=1 SV=1 4 554 5.0E-103
sp|D4AUH6|HEX1_ARTBC Beta-hexosaminidase ARB_07893 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07893 PE=1 SV=1 50 555 3.0E-98
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 106 555 2.0E-85
sp|P49010|HEXC_BOMMO Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori PE=1 SV=1 5 553 1.0E-84
sp|D4AYT4|HEX2_ARTBC Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01353 PE=1 SV=1 107 555 1.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SYK0|HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana GN=HEXO2 PE=1 SV=1 4 554 5.0E-103
sp|D4AUH6|HEX1_ARTBC Beta-hexosaminidase ARB_07893 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07893 PE=1 SV=1 50 555 3.0E-98
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 106 555 2.0E-85
sp|P49010|HEXC_BOMMO Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori PE=1 SV=1 5 553 1.0E-84
sp|D4AYT4|HEX2_ARTBC Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01353 PE=1 SV=1 107 555 1.0E-80
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 55 555 2.0E-80
sp|A7WM73|HEXO1_ARATH Beta-hexosaminidase 1 OS=Arabidopsis thaliana GN=HEXO1 PE=1 SV=1 95 553 2.0E-76
sp|Q8WSF3|FDL_DROME Probable beta-hexosaminidase fdl OS=Drosophila melanogaster GN=fdl PE=1 SV=1 11 553 3.0E-75
sp|P49614|HEXB_FELCA Beta-hexosaminidase subunit beta OS=Felis catus GN=HEXB PE=2 SV=2 19 546 1.0E-73
sp|P20060|HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus musculus GN=Hexb PE=1 SV=2 13 546 2.0E-73
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens GN=HEXB PE=1 SV=3 16 546 1.0E-70
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 73 549 5.0E-69
sp|Q0V8R6|HEXA_BOVIN Beta-hexosaminidase subunit alpha OS=Bos taurus GN=HEXA PE=2 SV=1 125 548 3.0E-66
sp|Q8L7S6|HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana GN=HEXO3 PE=1 SV=1 18 553 1.0E-65
sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens GN=HEXA PE=1 SV=2 20 546 6.0E-65
sp|Q5RC84|HEXA_PONAB Beta-hexosaminidase subunit alpha OS=Pongo abelii GN=HEXA PE=3 SV=1 125 546 1.0E-64
sp|Q6AXR4|HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus GN=Hexb PE=2 SV=1 19 546 2.0E-64
sp|Q641X3|HEXA_RAT Beta-hexosaminidase subunit alpha OS=Rattus norvegicus GN=Hexa PE=2 SV=1 125 546 4.0E-63
sp|P29416|HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus musculus GN=Hexa PE=1 SV=2 125 546 7.0E-62
sp|Q29548|HEXB_PIG Beta-hexosaminidase subunit beta OS=Sus scrofa GN=HEXB PE=1 SV=2 17 546 1.0E-59
sp|Q54SC9|HEXA2_DICDI Beta-hexosaminidase subunit A2 OS=Dictyostelium discoideum GN=hexa2 PE=3 SV=1 113 548 1.0E-58
sp|Q54K56|HEXB2_DICDI Beta-hexosaminidase subunit B2 OS=Dictyostelium discoideum GN=hexb2 PE=3 SV=1 18 553 2.0E-58
sp|Q54K55|HEXB1_DICDI Beta-hexosaminidase subunit B1 OS=Dictyostelium discoideum GN=hexb1 PE=3 SV=1 124 542 7.0E-58
sp|Q22492|HEXA_CAEEL Beta-hexosaminidase A OS=Caenorhabditis elegans GN=hex-1 PE=1 SV=1 19 548 9.0E-56
sp|Q619W7|HEXA_CAEBR Beta-hexosaminidase A OS=Caenorhabditis briggsae GN=hex-1 PE=3 SV=2 111 548 2.0E-54
sp|Q86M34|HEXB_ENTHI Beta-hexosaminidase subunit beta OS=Entamoeba histolytica GN=HEXB PE=1 SV=1 124 548 4.0E-44
sp|P49009|HEXA_ENTHI Beta-hexosaminidase subunit alpha OS=Entamoeba histolytica GN=HEXA PE=1 SV=2 124 548 1.0E-39
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 123 544 5.0E-39
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 139 508 5.0E-37
sp|Q7WUL4|HEX20_CELFI Beta-N-acetylhexosaminidase OS=Cellulomonas fimi GN=hex20 PE=1 SV=1 95 513 2.0E-36
sp|Q04786|HEX_VIBVL Beta-hexosaminidase OS=Vibrio vulnificus GN=hex PE=3 SV=1 126 510 2.0E-20
sp|Q54468|CHB_SERMA Chitobiase OS=Serratia marcescens GN=chb PE=1 SV=1 126 510 4.0E-20
sp|P13670|CHB_VIBHA N,N'-diacetylchitobiase OS=Vibrio harveyi GN=chb PE=1 SV=1 126 318 7.0E-16
sp|P49007|HEXB_PSEO7 Beta-hexosaminidase B OS=Pseudoalteromonas piscicida GN=nag096 PE=3 SV=1 127 277 1.0E-13
sp|P49610|STRH_STRPN Beta-N-acetylhexosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=strH PE=1 SV=2 187 539 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|099650
MKNFLSVFSIFLLCSPALALWPRPQNLTTGSTPLRLAQHFSIQFSDKKQNVPKDLQDAIRRTAQYLKDDKLQALV
VDRGASSSAEVRSAKTLSSLTLTFNDASSSSKKVKSLSEDATAGIGNQDESYSLQVSEDGNAVLTANTALGLFRG
LTTFGQLWYELDGETYTLQAPISIEDSPKYPYRGLLVDTARNYFPVKDIKRTLDTMSWVKMNHFHWHVVDSQSFP
LVVPGFEELSNNGAYSSDQVYTEKNVNDIVTYAAARGIDVMVEIDTPGHTSAIAKSFPEHIACAEASPWAQFANE
PPAGQLRLASPATVNFTSGLINAMTSMFPSTLFSTGGDEINANCYEMDNQTQSDLNASGKTLDEALASFVGATHE
VVRGAGKTPVVWEEIVLDHNVPVGNDTIVMVWISSDDVKAVADKGYRFIHAASDYFYLDCGGGGWVGNNINGNSW
CDPFKTWQKAYSFDPLNGTTPDQEHLVLGGEQLIWTEQTGPSNLDSIIWPRAAASAESFWSGPAGDVKTALPRLH
DIAYRFIQRGVRAIPLQPQYCALRPNACDIDA*
Coding >Agabi119p4|099650
ATGAAGAATTTCCTCTCCGTCTTTTCTATATTTCTCCTCTGTTCTCCAGCGTTGGCCCTCTGGCCAAGGCCACAA
AACCTGACCACCGGTTCAACACCACTTCGTCTCGCGCAACACTTTTCAATTCAATTCTCTGATAAGAAGCAGAAT
GTTCCAAAAGACCTTCAAGACGCTATTCGACGTACAGCTCAGTATCTCAAGGACGATAAACTCCAAGCCCTTGTA
GTTGATCGTGGAGCATCATCTTCAGCGGAAGTTCGTTCTGCGAAGACCCTATCTTCGCTCACCCTTACTTTCAAT
GACGCGTCTTCGTCTTCCAAGAAAGTGAAGAGCCTTAGCGAAGATGCGACGGCTGGTATTGGAAATCAGGATGAA
AGTTATAGCCTACAGGTCTCCGAGGACGGAAATGCAGTTTTGACTGCGAACACGGCGTTGGGGCTGTTTAGAGGA
TTGACAACTTTCGGACAGTTGTGGTATGAGTTGGATGGTGAGACGTATACTCTTCAAGCACCTATCAGCATTGAG
GATTCTCCCAAATACCCTTATCGTGGACTTCTTGTGGATACCGCTCGGAACTATTTTCCTGTGAAGGATATCAAG
CGCACTTTGGACACGATGAGCTGGGTCAAGATGAATCATTTCCATTGGCACGTTGTAGATTCTCAATCCTTCCCT
CTCGTCGTCCCCGGCTTCGAAGAATTATCAAACAACGGAGCATACTCATCAGATCAAGTCTACACGGAAAAAAAC
GTCAACGACATCGTCACGTATGCTGCTGCACGCGGTATCGACGTTATGGTTGAGATTGATACGCCGGGACATACA
TCTGCTATTGCAAAATCGTTCCCTGAACATATTGCATGCGCTGAAGCCTCACCCTGGGCGCAATTCGCCAACGAA
CCCCCCGCTGGTCAGCTTCGTCTGGCTTCTCCAGCCACAGTCAATTTCACTTCCGGCCTTATCAACGCTATGACA
TCCATGTTCCCCTCTACTCTCTTTAGCACTGGTGGTGACGAAATCAACGCTAATTGCTACGAAATGGATAACCAA
ACCCAAAGTGACCTGAATGCTTCAGGAAAGACACTGGATGAAGCCTTGGCTTCTTTTGTGGGTGCCACACATGAA
GTTGTTAGGGGAGCAGGAAAGACTCCTGTTGTTTGGGAAGAAATCGTTCTGGACCACAATGTGCCCGTCGGAAAT
GACACCATTGTCATGGTTTGGATTTCGTCAGATGATGTCAAAGCAGTGGCAGACAAGGGATACAGATTTATTCAT
GCCGCTTCCGATTACTTCTATCTTGATTGTGGAGGTGGAGGCTGGGTTGGTAACAATATCAATGGGAATAGCTGG
TGTGATCCATTCAAGACGTGGCAAAAGGCTTATTCCTTTGATCCTCTAAATGGAACGACGCCTGATCAAGAGCAT
TTGGTCCTCGGAGGTGAACAATTAATTTGGACAGAACAAACTGGACCTTCGAATTTGGATTCTATTATTTGGCCT
CGTGCTGCTGCTTCAGCCGAATCATTTTGGTCCGGGCCTGCTGGAGATGTCAAGACTGCTTTACCAAGATTACAC
GATATTGCGTATAGGTTTATTCAGAGGGGTGTCAGGGCTATTCCTTTGCAACCCCAGTATTGTGCTCTGAGACCT
AATGCTTGTGACATTGATGCATAA
Transcript >Agabi119p4|099650
ATGAAGAATTTCCTCTCCGTCTTTTCTATATTTCTCCTCTGTTCTCCAGCGTTGGCCCTCTGGCCAAGGCCACAA
AACCTGACCACCGGTTCAACACCACTTCGTCTCGCGCAACACTTTTCAATTCAATTCTCTGATAAGAAGCAGAAT
GTTCCAAAAGACCTTCAAGACGCTATTCGACGTACAGCTCAGTATCTCAAGGACGATAAACTCCAAGCCCTTGTA
GTTGATCGTGGAGCATCATCTTCAGCGGAAGTTCGTTCTGCGAAGACCCTATCTTCGCTCACCCTTACTTTCAAT
GACGCGTCTTCGTCTTCCAAGAAAGTGAAGAGCCTTAGCGAAGATGCGACGGCTGGTATTGGAAATCAGGATGAA
AGTTATAGCCTACAGGTCTCCGAGGACGGAAATGCAGTTTTGACTGCGAACACGGCGTTGGGGCTGTTTAGAGGA
TTGACAACTTTCGGACAGTTGTGGTATGAGTTGGATGGTGAGACGTATACTCTTCAAGCACCTATCAGCATTGAG
GATTCTCCCAAATACCCTTATCGTGGACTTCTTGTGGATACCGCTCGGAACTATTTTCCTGTGAAGGATATCAAG
CGCACTTTGGACACGATGAGCTGGGTCAAGATGAATCATTTCCATTGGCACGTTGTAGATTCTCAATCCTTCCCT
CTCGTCGTCCCCGGCTTCGAAGAATTATCAAACAACGGAGCATACTCATCAGATCAAGTCTACACGGAAAAAAAC
GTCAACGACATCGTCACGTATGCTGCTGCACGCGGTATCGACGTTATGGTTGAGATTGATACGCCGGGACATACA
TCTGCTATTGCAAAATCGTTCCCTGAACATATTGCATGCGCTGAAGCCTCACCCTGGGCGCAATTCGCCAACGAA
CCCCCCGCTGGTCAGCTTCGTCTGGCTTCTCCAGCCACAGTCAATTTCACTTCCGGCCTTATCAACGCTATGACA
TCCATGTTCCCCTCTACTCTCTTTAGCACTGGTGGTGACGAAATCAACGCTAATTGCTACGAAATGGATAACCAA
ACCCAAAGTGACCTGAATGCTTCAGGAAAGACACTGGATGAAGCCTTGGCTTCTTTTGTGGGTGCCACACATGAA
GTTGTTAGGGGAGCAGGAAAGACTCCTGTTGTTTGGGAAGAAATCGTTCTGGACCACAATGTGCCCGTCGGAAAT
GACACCATTGTCATGGTTTGGATTTCGTCAGATGATGTCAAAGCAGTGGCAGACAAGGGATACAGATTTATTCAT
GCCGCTTCCGATTACTTCTATCTTGATTGTGGAGGTGGAGGCTGGGTTGGTAACAATATCAATGGGAATAGCTGG
TGTGATCCATTCAAGACGTGGCAAAAGGCTTATTCCTTTGATCCTCTAAATGGAACGACGCCTGATCAAGAGCAT
TTGGTCCTCGGAGGTGAACAATTAATTTGGACAGAACAAACTGGACCTTCGAATTTGGATTCTATTATTTGGCCT
CGTGCTGCTGCTTCAGCCGAATCATTTTGGTCCGGGCCTGCTGGAGATGTCAAGACTGCTTTACCAAGATTACAC
GATATTGCGTATAGGTTTATTCAGAGGGGTGTCAGGGCTATTCCTTTGCAACCCCAGTATTGTGCTCTGAGACCT
AATGCTTGTGACATTGATGCATAA
Gene >Agabi119p4|099650
ATGAAGAATTTCCTCTCCGTCTTTTCTATATTTCTCCTCTGTTCTCCAGCGTTGGCCCTCTGGCCAAGGCCACAA
AACCTGACCACCGGTTCAACACCACTTCGTCTCGCGCAACACTTTTCAATTCAATTCTCTGATAAGAAGCAGAAT
GTTCCAAAAGACCTTCAAGACGCTATTCGACGTACAGCTCAGTATCTCAAGGACGATAAACTCCAAGCCCTTGTA
GTTGATCGTGGAGCATCATCTTCAGCGGAAGTTCGTTCTGCGAAGACCCTATCTTCGCTCACCCTTACTTTCAAT
GACGCGTCTTCGTCTTCCAAGAAAGTGAAGAGCCTTAGCGAAGATGCGACGGCTGGTATTGGAAATCAGGATGAA
AGTTATAGCCTACAGGTCTCCGAGGACGGAAATGCAGTTTTGACTGCGAACACGGCGTTGGGGCTGTTTAGAGGA
TTGACAACTTTCGGACAGTTGTGGTATGAGTTGGATGGTGAGACGTATACTCTTCAAGCACCTATCAGCATTGAG
GATTCTCCCAAATACGTGAGTCACGCAAGTAATATCTCTGGCTTGATTTTTGGACTGACGAGACTGTTGGCAGCC
TTATCGTGGACTTCTTGTGGATACCGCTCGGAACTAGTGAGTGCAAGGGGAAAATTACGCACTGCATCCCATATA
CTCAACTTAACTCCTAGTTTTCCTGTGAAGGATATCAAGCGCACTTTGGACACGATGAGCTGGGTCAAGATGAAT
CATTTCCATTGGCACGTTGTAGATTCTCAATCCTTCCCTCTCGTCGTCCCCGGCTTCGAAGAATTATCAAACAAC
GGAGCATACTCATCAGATCAAGTCTACACGGAAAAAAACGTCAACGACATCGTCACGTATGCTGCTGCAGTATGC
TATCAATTCTCTCGTCTCCTCCTGGATATTAATCGCGTGAATACACTAGCGCGGTATCGACGTTATGGTTGAGAT
TGATACGCCGGGACATACATCTGCTATTGCAAAATCGTTCCCTGAACATATTGCATGCGCTGAAGCCTCACCCTG
GGCGCAATTCGCCAACGGTAATTACATCTTGTTTGTTTATCGAATACGGCGTTGATATGCCTCTCTCAGAACCCC
CCGCTGGTCAGCTTCGTCTGGCTTCTCCAGCCACAGTCAATTTCACTTCCGGCCTTATCAACGCTATGACATCCA
TGTTCCCCTCTACTCTCTTTAGCACTGGTGGTGACGAAATCAACGCTAATTGCTACGAAATGGATAACCAAACCC
AAAGTGACCTGAGTGCGTTTATATTCGTCTTTTATTCAGGCACACATTTAACGCGCGCTTCTGAAATATAGATGC
TTCAGGAAAGACACTGGATGAAGCCTTGGCTTCTTTTGTGGGTGCCACACATGAAGTTGTTAGGGGAGCAGGAAA
GACTCCTGTTGTTTGGGAAGGTACGTTTATCACTAGTAGACTAAAAGGACGTCTAATAAAATTCATCATTAGAAA
TCGTTCTGGACCACAATGTGCCCGTCGGAAATGACACCATTGTCATGTAGGTGCCTCATCACTTACTCTTACTGT
ACTGACGCATTGGAATGATTCAGGGTTTGGATTTCGTCAGATGATGTCAAAGCAGTGGCAGACAAGGGATACAGA
TTTATTCATGCCGCTTCCGATTACTTCTATCTTGATTGTGGAGGTGGAGGCTGGGTTGGTAACAATATCAATGGG
AATAGCTGGTGTGATCCATTCAAGACGTGGCAAAAGGCTTATTCCTTTGATCCTCTAAATGGAACGACGCCTGAT
CAAGAGCATTTGGTCCTCGGAGGTCTGTATTCCCCTCCTACCCCCCTACGAACATTCATTTCGCTGACAAGAATG
AACATTTGGCAGGTGAACAATTAATTTGGACAGAACAAACTGGACCTTCGAATTTGGATTCTATTATTTGGCCTC
GTGCTGCTGCTTCAGCCGAATCATTTTGGTCCGGGCCTGCTGGAGATGTCAAGACTGCTTTACCAAGATTACACG
ATATTGCGTATAGGTTTATTCAGAGGGGTGTCAGGGCTATTCCTTTGCAACCCCAGTATTGTGCTCTGAGACCTA
ATGCTTGTGACATTGATGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail