Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|099300
Gene name
Locationscaffold_07:547421..555009
Strand+
Gene length (bp)7588
Transcript length (bp)6132
Coding sequence length (bp)6132
Protein length (aa) 2044

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12830 Nipped-B_C Sister chromatid cohesion C-terminus 1.2E-56 1693 1876
PF12765 Cohesin_HEAT HEAT repeat associated with sister chromatid cohesion 6.0E-12 1186 1227
PF20168 PDS5 Sister chromatid cohesion protein PDS5 protein 1.2E-07 1172 1309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00333|NPBL_COPC7 Protein rad9 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=rad9 PE=2 SV=2 1 2042 0.0E+00
sp|Q6KC79|NIPBL_HUMAN Nipped-B-like protein OS=Homo sapiens GN=NIPBL PE=1 SV=2 641 1892 1.0E-108
sp|Q6KCD5|NIPBL_MOUSE Nipped-B-like protein OS=Mus musculus GN=Nipbl PE=1 SV=1 641 1892 3.0E-108
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 624 1894 1.0E-104
sp|F5HSE3|NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio GN=nipbla PE=2 SV=1 624 1892 4.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00333|NPBL_COPC7 Protein rad9 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=rad9 PE=2 SV=2 1 2042 0.0E+00
sp|Q6KC79|NIPBL_HUMAN Nipped-B-like protein OS=Homo sapiens GN=NIPBL PE=1 SV=2 641 1892 1.0E-108
sp|Q6KCD5|NIPBL_MOUSE Nipped-B-like protein OS=Mus musculus GN=Nipbl PE=1 SV=1 641 1892 3.0E-108
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 624 1894 1.0E-104
sp|F5HSE3|NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio GN=nipbla PE=2 SV=1 624 1892 4.0E-95
sp|Q95XZ5|NPBL_CAEEL Nipped-B-like protein pqn-85 OS=Caenorhabditis elegans GN=pqn-85 PE=3 SV=2 641 1999 8.0E-72
sp|Q09725|MIS4_SCHPO Sister chromatid cohesion protein mis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis4 PE=1 SV=2 691 1882 1.0E-58
sp|Q7PLI2|NIPB_DROME Nipped-B protein OS=Drosophila melanogaster GN=Nipped-B PE=1 SV=3 1148 2026 2.0E-52
sp|Q750S2|SCC2_ASHGO Sister chromatid cohesion protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SCC2 PE=1 SV=1 797 1877 4.0E-36
sp|Q04002|SCC2_YEAST Sister chromatid cohesion protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCC2 PE=1 SV=1 1162 1771 1.0E-31
sp|Q7PLI2|NIPB_DROME Nipped-B protein OS=Drosophila melanogaster GN=Nipped-B PE=1 SV=3 744 1018 2.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|099300
MDNNPRWRPQDQYFYHQEPPEQPQQNIRYGSAAADSVHHAQGLLAVYPMASATPTNHAVRHMNNMYTTAAPPTFA
QPSYYAPRTSYSPQGNPPPYSEYDHQVRYLSSPQPSVNDGGYWTTARDNSVRILADQPASSYRYPAQQNWRPPQG
PVSSFQPSPFAQSVFQRTAPPNNAYPTPSPPVMQTSSSSLAHALGPPPHVPQRLPPDPRPPPPQKVYRPEESRAF
FNTFLEQKTREMQIAMHPRSRPVASPFKTPAPVKASSPAKTPVPVRTPVTKLTAAALNQPSPQSSPDPLSIMTYS
SPVPVTPRKRKPVVEIESPSLKRLQTMRDEYVLPTQRSSSASAASSVPTTPTSNSAASTNSKGPTPTPKRTPNFA
YVSVPRPTWATPYTRPNGFTTPSMSRRKFKMDDHSPDLGGYGPVDGDGSPIKRRNITDSAKSSVRRTGDRDDRAP
LEKFLCLIEDIFDSEDALPAEISISDLPDYFSSLSLDSSQPQLHSNHIRKLTKYIGQVARPNQRLRNTTAGVMNT
PRTQGRMAQIDTQVLSRLLKVLDRSVKTGEDLDPFKYVAPSAGPPKSSPRKKAAKAKKPDTSQSQMVKGGSDDTT
GQDTDRRSTEEEDREPEMELTSVDHKQLTRSLNIARESILAADCCIALLGSDRLTKQLYSEELIISCFNAVKNQL
EKVIYPFVETSTGMAFEFGGNPMLRFIVQDNSSTASSHRKQLSELFQALSSVIPRINNLLNAETVAMSDTIIISA
VYIAIGPFFVVEGEGESKGKKEKDNVILKTFGKSAMRGLRLDALGLIRSIFANNESQRSWIIEEILTSLIKLSDT
KQKAGSFRLRDGRSIRTVSALLLQLVQTSAHDVRLKARKIEKNRQNQLALKRQESFSESQQAQEPFLDENDHEEI
VLYKGGLDSAMQAAKTIIGFLTKRSGKGKTTKNSNEAEYRAIFDNLIGDLLVVLFWPEWPAAGVLLTMICRYMVN
ALSDKHVNAQIDSNAAKTMALDHLGVIAARIRSATLKYQVKVDEEAKVRPLRSIDEIVDGQDIKAFERLLKAHRD
VMAHIARRSSEDQAYDSARELSAAILGQELATALQQLQKWIEMPELDDDLDLKDPRDTNKMLTFGRKVRGALRDV
WKDPPTDVFDVGSQEEVDRIDQLGEQIGTLQAMRSSFDPILNTIVASLNAPVIFIRTKALRALGQIVTSDPVVLS
MPIVRRGIENHLLDSSPAVRDAAVELIGKYMIDSPEVAGNYYQKIADRMADTGLGVRKRVIKLLKSFYSVTQDNN
CKIDIATRMVARMMDEDDTVKELAIKTIEELWFPTVPTTTVNTRTKSAPADHNQSDKNSILAKVIVIMGTAAQFK
ERQSPLEDLLHKIMAEKPENEVPALHARYSEICETLIDGLVDATDMPGFTVVNCIRTIYLFTSAYPPVLSGSNAS
TLLPYLKSTSSNEELITTDYLLKVFRVSIPHMSPTAGKFGQDLQLALQPMIIKPSGSGGVQILQEAVGCMCVVVQ
HLTHDFIRLVNLLKSCNARLQQAIKRPSAAQMEDKETRPLVILILIVALLGEHCQFDQLRAENTDIAKEIDAISK
GSIIEHIYDTLLQLYQKYHSTPMLRGRTLQCLGFLFRAQPTLMTKERSASVMDAIFASPEEDGKGRLLRIMQEFL
VSESEKNSARLKETTKGKSSKPTNINMDELVGNTDGFADSGVSSAIVQRYLDQVLEAALSPASTNQGAAVDVLSF
TIKQGLAHPLQSFPVIIALETSPVTSLSNRATALHSILQGKHASLINTRYIFSARASFEYQKKIAGSQEVKGYRT
EPSPVALLQRWFSLIREKRVQRQEFLKSLVKVFQENSDYQSTQDDVDFMRYMAENFAMFDYKTQEEVITVIKHLT
VVLSTSGMHLLEMISPSHLLSQLRAPLETAQESASQKNPDTNAMVVDPPSEPQTISMVPIPVEDNLDKLPLMRTS
VIIAMVMLLKAHLKSLYSISEEKCNKFVVGKKSAAGDKPATRRNDKPISWNRLPYATSPMLTTEDIQVQKAKFLD
IWNEDGVTAEPDDELEFA*
Coding >Agabi119p4|099300
ATGGACAACAACCCTCGCTGGCGGCCCCAGGACCAGTACTTCTACCACCAGGAGCCACCCGAGCAGCCCCAGCAG
AACATTCGCTATGGTTCCGCCGCGGCAGACTCTGTTCACCATGCCCAGGGTCTTCTGGCAGTATACCCGATGGCT
TCTGCTACCCCAACAAATCATGCCGTGCGGCATATGAACAACATGTACACTACTGCGGCGCCCCCGACATTTGCT
CAGCCGTCGTACTATGCTCCCCGTACTTCGTATTCGCCCCAAGGGAACCCGCCGCCATATTCGGAGTATGATCAT
CAAGTTCGATATCTCTCTTCACCTCAACCTTCGGTGAATGACGGGGGGTACTGGACTACTGCGCGGGATAATTCT
GTCCGCATACTAGCGGATCAACCAGCTTCTTCTTATCGTTATCCCGCTCAGCAAAACTGGCGTCCTCCACAGGGT
CCCGTATCTTCCTTTCAACCGTCACCTTTTGCGCAATCGGTATTTCAACGCACCGCTCCCCCAAATAATGCGTAC
CCGACACCTTCACCACCGGTAATGCAGACCTCATCGTCTTCTCTTGCGCATGCTTTAGGTCCCCCGCCTCATGTG
CCACAAAGACTCCCTCCTGATCCGCGACCCCCTCCACCGCAAAAGGTTTATCGCCCGGAAGAGTCGCGGGCATTT
TTCAATACCTTCCTAGAGCAAAAGACTCGAGAAATGCAGATTGCAATGCACCCTCGATCTCGCCCTGTAGCCAGT
CCATTCAAAACACCTGCTCCAGTAAAGGCGTCTTCTCCTGCGAAAACGCCTGTTCCAGTGAGAACGCCTGTCACG
AAACTCACTGCTGCCGCACTGAATCAGCCATCCCCCCAATCGAGTCCTGATCCGTTGTCTATCATGACGTACAGT
TCTCCGGTCCCTGTTACTCCTCGTAAGCGAAAGCCAGTCGTTGAAATAGAATCTCCGTCTTTGAAGCGTCTGCAG
ACGATGCGAGATGAGTATGTGCTACCAACGCAGCGCTCCTCCTCTGCTTCAGCAGCATCTTCTGTTCCTACAACC
CCAACTTCCAACTCGGCCGCATCCACTAATTCAAAGGGTCCCACTCCCACTCCCAAGCGCACTCCAAATTTCGCG
TACGTTTCGGTCCCTCGTCCTACCTGGGCGACACCTTATACCCGACCGAATGGGTTTACCACACCCTCAATGTCA
CGCAGAAAATTCAAAATGGACGACCACTCACCTGATCTCGGTGGTTATGGTCCCGTGGATGGGGATGGGAGTCCT
ATCAAACGCCGTAATATAACGGATTCAGCCAAAAGTTCTGTTCGTAGAACGGGAGACCGCGACGATCGTGCCCCA
CTCGAAAAGTTTTTATGCTTAATCGAGGATATTTTCGATTCCGAAGACGCCCTACCCGCCGAGATCAGCATTAGT
GACTTACCAGATTATTTTTCATCCCTTTCGCTCGATTCCTCCCAACCGCAGTTGCATTCTAATCATATTCGTAAG
CTCACGAAATATATTGGTCAAGTGGCCCGTCCGAACCAGCGACTCCGGAACACAACTGCGGGCGTCATGAATACG
CCACGGACGCAGGGGCGCATGGCCCAGATTGATACTCAGGTTTTATCGCGATTGCTCAAGGTTTTGGATCGATCT
GTCAAAACCGGCGAGGATTTGGATCCCTTCAAATATGTCGCACCGTCGGCAGGACCTCCTAAGAGCTCTCCTCGG
AAAAAAGCCGCGAAAGCCAAGAAACCAGATACTTCTCAATCACAGATGGTTAAAGGAGGTTCGGATGATACCACT
GGTCAAGATACTGATCGCAGAAGTACTGAAGAAGAAGATCGTGAGCCTGAAATGGAGCTGACCAGCGTGGATCAT
AAACAATTGACGCGGTCCTTAAACATCGCTCGAGAGAGCATTTTGGCTGCCGATTGCTGTATTGCGTTGCTTGGA
AGCGACAGGCTGACCAAACAGTTATATTCTGAAGAGCTGATCATTTCTTGCTTTAATGCCGTTAAAAACCAACTT
GAGAAGGTCATTTATCCATTTGTAGAGACGTCAACAGGAATGGCTTTCGAATTTGGCGGTAATCCAATGCTCCGT
TTTATCGTTCAAGACAACTCCTCGACTGCATCGTCTCATCGGAAGCAACTGAGCGAGTTGTTCCAGGCCTTGTCC
AGCGTTATCCCGCGCATCAACAATCTTCTGAATGCTGAAACTGTTGCGATGTCGGATACGATTATCATTTCCGCG
GTATACATTGCAATAGGACCATTTTTCGTCGTTGAAGGGGAAGGTGAATCGAAAGGCAAAAAAGAAAAAGACAAC
GTCATTTTGAAAACTTTTGGTAAGAGTGCTATGAGGGGTCTGCGCTTAGATGCCTTGGGTTTGATCAGGAGTATC
TTCGCTAATAATGAGAGCCAACGGTCATGGATTATCGAGGAGATTCTGACTTCATTAATCAAGCTATCAGATACG
AAGCAGAAAGCCGGTTCATTCCGACTCCGCGATGGTCGATCTATACGAACGGTTTCTGCCTTGTTGTTGCAACTC
GTTCAAACCTCAGCGCATGACGTACGACTGAAAGCGAGAAAAATAGAGAAGAACAGACAGAACCAGTTGGCTTTG
AAACGCCAAGAAAGCTTTTCGGAAAGTCAACAAGCACAGGAACCTTTTCTGGATGAGAATGACCATGAGGAAATT
GTGCTTTACAAAGGAGGCTTGGATTCGGCGATGCAAGCTGCGAAAACCATTATCGGCTTTTTGACTAAACGCTCG
GGCAAAGGCAAGACAACGAAAAATTCAAATGAGGCGGAGTATCGCGCTATCTTCGATAACCTGATCGGTGATCTT
CTGGTTGTGCTCTTCTGGCCGGAATGGCCAGCCGCCGGAGTTTTGTTGACTATGATCTGTCGATACATGGTCAAC
GCGCTGAGCGACAAACATGTGAATGCACAGATTGATTCGAATGCAGCCAAGACGATGGCGCTCGATCATCTTGGT
GTCATTGCTGCCAGAATACGATCCGCAACGCTCAAGTACCAAGTGAAAGTGGATGAAGAAGCCAAAGTCCGACCA
TTGAGATCAATAGATGAGATCGTAGATGGACAAGATATCAAGGCATTTGAGCGCTTGTTGAAGGCCCACAGAGAC
GTCATGGCTCATATCGCTAGGCGGTCTTCCGAAGACCAAGCATACGATAGTGCACGGGAGCTATCGGCAGCAATC
CTAGGACAGGAACTTGCTACTGCACTTCAGCAACTGCAGAAGTGGATCGAGATGCCCGAGTTGGATGATGATCTC
GATCTTAAGGATCCTCGGGATACCAATAAGATGCTCACCTTTGGCCGCAAAGTTAGGGGTGCATTAAGGGACGTC
TGGAAAGATCCTCCTACGGACGTATTCGATGTTGGGTCACAAGAAGAAGTAGATCGGATTGATCAACTTGGAGAA
CAGATTGGGACACTTCAAGCCATGCGCAGCTCCTTTGACCCAATTCTGAACACTATCGTCGCATCGCTGAATGCG
CCAGTCATTTTTATCCGTACGAAGGCACTTCGTGCCCTTGGACAGATCGTCACCAGCGATCCCGTCGTGTTGTCC
ATGCCAATCGTTCGTCGTGGCATAGAAAACCACCTGCTTGATAGTTCACCTGCCGTTCGAGATGCCGCAGTTGAG
CTGATTGGCAAGTACATGATTGACTCGCCGGAGGTGGCGGGGAACTATTATCAGAAAATCGCTGACCGAATGGCC
GACACTGGTCTTGGTGTGCGAAAACGCGTGATAAAGCTCCTTAAATCATTTTACAGTGTCACTCAAGACAACAAC
TGCAAGATTGATATCGCAACTCGGATGGTTGCCCGGATGATGGATGAAGATGATACAGTGAAAGAGCTCGCCATC
AAAACCATTGAAGAGTTATGGTTTCCCACTGTGCCCACCACAACAGTCAATACCCGGACCAAGTCCGCCCCCGCT
GACCACAATCAGAGTGACAAGAATTCAATCCTTGCGAAAGTGATTGTAATAATGGGCACGGCCGCTCAATTTAAG
GAGCGACAGTCGCCACTTGAGGACTTATTACACAAGATTATGGCCGAAAAGCCGGAGAACGAGGTTCCAGCTCTC
CATGCTCGATATTCAGAAATTTGCGAGACGTTGATAGATGGATTAGTGGATGCTACGGACATGCCGGGATTTACG
GTTGTCAACTGCATACGGACTATCTACTTGTTCACTTCGGCATACCCACCAGTGCTCTCTGGTTCAAATGCGTCG
ACATTGCTTCCGTACCTCAAAAGCACTTCATCGAATGAGGAGTTAATAACGACCGATTATCTACTCAAAGTTTTC
CGGGTATCGATTCCCCACATGTCACCAACGGCAGGCAAGTTTGGGCAAGACCTGCAGCTGGCCTTGCAGCCCATG
ATCATCAAACCTTCTGGAAGTGGTGGCGTTCAAATTCTGCAAGAGGCTGTCGGTTGCATGTGTGTAGTGGTACAA
CATCTGACGCATGACTTCATTCGCTTGGTGAACCTTCTCAAGTCTTGTAATGCTCGCCTCCAACAAGCCATCAAA
CGTCCTTCCGCGGCGCAGATGGAGGATAAAGAGACTCGTCCACTGGTGATTCTAATCCTAATCGTCGCCCTACTA
GGGGAACATTGTCAATTTGATCAGCTGAGGGCGGAGAATACAGATATTGCAAAGGAGATCGATGCTATCTCGAAG
GGATCAATCATAGAGCATATCTACGACACTTTATTACAGTTATACCAGAAGTATCATAGCACGCCGATGCTTCGT
GGGAGAACCCTACAGTGTCTTGGCTTCCTATTTCGAGCACAACCCACTTTGATGACCAAGGAGCGCTCCGCTAGT
GTCATGGACGCCATCTTTGCCTCACCGGAAGAAGATGGTAAAGGTCGCTTGCTCAGGATCATGCAAGAATTCTTG
GTGTCAGAGTCTGAAAAGAATTCTGCGAGATTGAAAGAAACGACAAAGGGTAAGTCAAGCAAACCCACCAACATC
AATATGGACGAATTAGTGGGGAACACTGACGGTTTTGCGGACTCTGGTGTCAGTTCTGCCATTGTGCAACGATAT
CTGGATCAAGTTCTCGAAGCTGCCCTCTCCCCTGCATCCACAAATCAGGGTGCTGCTGTGGATGTTCTGAGCTTT
ACAATCAAGCAGGGTTTAGCTCATCCACTCCAATCCTTCCCCGTCATCATTGCGCTCGAGACCAGTCCAGTTACC
AGTCTGAGCAATCGTGCTACCGCTCTACATTCGATCCTCCAAGGAAAGCATGCCTCACTGATCAATACGAGATAC
ATTTTTAGTGCGCGAGCTTCTTTTGAATATCAGAAGAAGATTGCTGGATCTCAGGAAGTGAAAGGTTACCGCACC
GAACCCAGCCCTGTTGCACTGTTACAACGGTGGTTTTCGCTCATCCGAGAGAAGAGAGTCCAGCGTCAAGAGTTC
CTTAAATCTCTGGTCAAAGTATTCCAAGAGAACTCTGATTACCAGTCAACTCAAGACGATGTCGATTTCATGAGG
TACATGGCCGAAAATTTCGCCATGTTCGACTACAAGACTCAAGAAGAGGTTATTACGGTGATAAAGCACCTTACC
GTTGTCTTGTCAACGTCCGGCATGCATCTACTCGAGATGATTTCACCTTCCCATCTGCTAAGTCAACTTCGTGCA
CCATTGGAGACCGCGCAGGAGAGCGCCTCTCAGAAAAATCCTGACACCAATGCCATGGTCGTTGACCCGCCTTCG
GAACCTCAAACTATTTCAATGGTCCCCATTCCAGTTGAAGACAACCTGGACAAGCTTCCTCTAATGCGCACGAGC
GTGATTATTGCCATGGTAATGCTTCTAAAAGCACACCTTAAGTCGCTGTATTCAATATCCGAAGAAAAATGCAAC
AAATTTGTTGTGGGCAAAAAGAGTGCTGCAGGCGACAAACCCGCTACCAGACGAAACGATAAACCTATCTCATGG
AATCGGCTACCCTATGCCACCTCTCCGATGTTGACGACCGAAGACATTCAAGTTCAGAAAGCTAAGTTCCTTGAC
ATTTGGAATGAAGATGGTGTTACAGCTGAACCTGACGACGAACTTGAATTTGCTTGA
Transcript >Agabi119p4|099300
ATGGACAACAACCCTCGCTGGCGGCCCCAGGACCAGTACTTCTACCACCAGGAGCCACCCGAGCAGCCCCAGCAG
AACATTCGCTATGGTTCCGCCGCGGCAGACTCTGTTCACCATGCCCAGGGTCTTCTGGCAGTATACCCGATGGCT
TCTGCTACCCCAACAAATCATGCCGTGCGGCATATGAACAACATGTACACTACTGCGGCGCCCCCGACATTTGCT
CAGCCGTCGTACTATGCTCCCCGTACTTCGTATTCGCCCCAAGGGAACCCGCCGCCATATTCGGAGTATGATCAT
CAAGTTCGATATCTCTCTTCACCTCAACCTTCGGTGAATGACGGGGGGTACTGGACTACTGCGCGGGATAATTCT
GTCCGCATACTAGCGGATCAACCAGCTTCTTCTTATCGTTATCCCGCTCAGCAAAACTGGCGTCCTCCACAGGGT
CCCGTATCTTCCTTTCAACCGTCACCTTTTGCGCAATCGGTATTTCAACGCACCGCTCCCCCAAATAATGCGTAC
CCGACACCTTCACCACCGGTAATGCAGACCTCATCGTCTTCTCTTGCGCATGCTTTAGGTCCCCCGCCTCATGTG
CCACAAAGACTCCCTCCTGATCCGCGACCCCCTCCACCGCAAAAGGTTTATCGCCCGGAAGAGTCGCGGGCATTT
TTCAATACCTTCCTAGAGCAAAAGACTCGAGAAATGCAGATTGCAATGCACCCTCGATCTCGCCCTGTAGCCAGT
CCATTCAAAACACCTGCTCCAGTAAAGGCGTCTTCTCCTGCGAAAACGCCTGTTCCAGTGAGAACGCCTGTCACG
AAACTCACTGCTGCCGCACTGAATCAGCCATCCCCCCAATCGAGTCCTGATCCGTTGTCTATCATGACGTACAGT
TCTCCGGTCCCTGTTACTCCTCGTAAGCGAAAGCCAGTCGTTGAAATAGAATCTCCGTCTTTGAAGCGTCTGCAG
ACGATGCGAGATGAGTATGTGCTACCAACGCAGCGCTCCTCCTCTGCTTCAGCAGCATCTTCTGTTCCTACAACC
CCAACTTCCAACTCGGCCGCATCCACTAATTCAAAGGGTCCCACTCCCACTCCCAAGCGCACTCCAAATTTCGCG
TACGTTTCGGTCCCTCGTCCTACCTGGGCGACACCTTATACCCGACCGAATGGGTTTACCACACCCTCAATGTCA
CGCAGAAAATTCAAAATGGACGACCACTCACCTGATCTCGGTGGTTATGGTCCCGTGGATGGGGATGGGAGTCCT
ATCAAACGCCGTAATATAACGGATTCAGCCAAAAGTTCTGTTCGTAGAACGGGAGACCGCGACGATCGTGCCCCA
CTCGAAAAGTTTTTATGCTTAATCGAGGATATTTTCGATTCCGAAGACGCCCTACCCGCCGAGATCAGCATTAGT
GACTTACCAGATTATTTTTCATCCCTTTCGCTCGATTCCTCCCAACCGCAGTTGCATTCTAATCATATTCGTAAG
CTCACGAAATATATTGGTCAAGTGGCCCGTCCGAACCAGCGACTCCGGAACACAACTGCGGGCGTCATGAATACG
CCACGGACGCAGGGGCGCATGGCCCAGATTGATACTCAGGTTTTATCGCGATTGCTCAAGGTTTTGGATCGATCT
GTCAAAACCGGCGAGGATTTGGATCCCTTCAAATATGTCGCACCGTCGGCAGGACCTCCTAAGAGCTCTCCTCGG
AAAAAAGCCGCGAAAGCCAAGAAACCAGATACTTCTCAATCACAGATGGTTAAAGGAGGTTCGGATGATACCACT
GGTCAAGATACTGATCGCAGAAGTACTGAAGAAGAAGATCGTGAGCCTGAAATGGAGCTGACCAGCGTGGATCAT
AAACAATTGACGCGGTCCTTAAACATCGCTCGAGAGAGCATTTTGGCTGCCGATTGCTGTATTGCGTTGCTTGGA
AGCGACAGGCTGACCAAACAGTTATATTCTGAAGAGCTGATCATTTCTTGCTTTAATGCCGTTAAAAACCAACTT
GAGAAGGTCATTTATCCATTTGTAGAGACGTCAACAGGAATGGCTTTCGAATTTGGCGGTAATCCAATGCTCCGT
TTTATCGTTCAAGACAACTCCTCGACTGCATCGTCTCATCGGAAGCAACTGAGCGAGTTGTTCCAGGCCTTGTCC
AGCGTTATCCCGCGCATCAACAATCTTCTGAATGCTGAAACTGTTGCGATGTCGGATACGATTATCATTTCCGCG
GTATACATTGCAATAGGACCATTTTTCGTCGTTGAAGGGGAAGGTGAATCGAAAGGCAAAAAAGAAAAAGACAAC
GTCATTTTGAAAACTTTTGGTAAGAGTGCTATGAGGGGTCTGCGCTTAGATGCCTTGGGTTTGATCAGGAGTATC
TTCGCTAATAATGAGAGCCAACGGTCATGGATTATCGAGGAGATTCTGACTTCATTAATCAAGCTATCAGATACG
AAGCAGAAAGCCGGTTCATTCCGACTCCGCGATGGTCGATCTATACGAACGGTTTCTGCCTTGTTGTTGCAACTC
GTTCAAACCTCAGCGCATGACGTACGACTGAAAGCGAGAAAAATAGAGAAGAACAGACAGAACCAGTTGGCTTTG
AAACGCCAAGAAAGCTTTTCGGAAAGTCAACAAGCACAGGAACCTTTTCTGGATGAGAATGACCATGAGGAAATT
GTGCTTTACAAAGGAGGCTTGGATTCGGCGATGCAAGCTGCGAAAACCATTATCGGCTTTTTGACTAAACGCTCG
GGCAAAGGCAAGACAACGAAAAATTCAAATGAGGCGGAGTATCGCGCTATCTTCGATAACCTGATCGGTGATCTT
CTGGTTGTGCTCTTCTGGCCGGAATGGCCAGCCGCCGGAGTTTTGTTGACTATGATCTGTCGATACATGGTCAAC
GCGCTGAGCGACAAACATGTGAATGCACAGATTGATTCGAATGCAGCCAAGACGATGGCGCTCGATCATCTTGGT
GTCATTGCTGCCAGAATACGATCCGCAACGCTCAAGTACCAAGTGAAAGTGGATGAAGAAGCCAAAGTCCGACCA
TTGAGATCAATAGATGAGATCGTAGATGGACAAGATATCAAGGCATTTGAGCGCTTGTTGAAGGCCCACAGAGAC
GTCATGGCTCATATCGCTAGGCGGTCTTCCGAAGACCAAGCATACGATAGTGCACGGGAGCTATCGGCAGCAATC
CTAGGACAGGAACTTGCTACTGCACTTCAGCAACTGCAGAAGTGGATCGAGATGCCCGAGTTGGATGATGATCTC
GATCTTAAGGATCCTCGGGATACCAATAAGATGCTCACCTTTGGCCGCAAAGTTAGGGGTGCATTAAGGGACGTC
TGGAAAGATCCTCCTACGGACGTATTCGATGTTGGGTCACAAGAAGAAGTAGATCGGATTGATCAACTTGGAGAA
CAGATTGGGACACTTCAAGCCATGCGCAGCTCCTTTGACCCAATTCTGAACACTATCGTCGCATCGCTGAATGCG
CCAGTCATTTTTATCCGTACGAAGGCACTTCGTGCCCTTGGACAGATCGTCACCAGCGATCCCGTCGTGTTGTCC
ATGCCAATCGTTCGTCGTGGCATAGAAAACCACCTGCTTGATAGTTCACCTGCCGTTCGAGATGCCGCAGTTGAG
CTGATTGGCAAGTACATGATTGACTCGCCGGAGGTGGCGGGGAACTATTATCAGAAAATCGCTGACCGAATGGCC
GACACTGGTCTTGGTGTGCGAAAACGCGTGATAAAGCTCCTTAAATCATTTTACAGTGTCACTCAAGACAACAAC
TGCAAGATTGATATCGCAACTCGGATGGTTGCCCGGATGATGGATGAAGATGATACAGTGAAAGAGCTCGCCATC
AAAACCATTGAAGAGTTATGGTTTCCCACTGTGCCCACCACAACAGTCAATACCCGGACCAAGTCCGCCCCCGCT
GACCACAATCAGAGTGACAAGAATTCAATCCTTGCGAAAGTGATTGTAATAATGGGCACGGCCGCTCAATTTAAG
GAGCGACAGTCGCCACTTGAGGACTTATTACACAAGATTATGGCCGAAAAGCCGGAGAACGAGGTTCCAGCTCTC
CATGCTCGATATTCAGAAATTTGCGAGACGTTGATAGATGGATTAGTGGATGCTACGGACATGCCGGGATTTACG
GTTGTCAACTGCATACGGACTATCTACTTGTTCACTTCGGCATACCCACCAGTGCTCTCTGGTTCAAATGCGTCG
ACATTGCTTCCGTACCTCAAAAGCACTTCATCGAATGAGGAGTTAATAACGACCGATTATCTACTCAAAGTTTTC
CGGGTATCGATTCCCCACATGTCACCAACGGCAGGCAAGTTTGGGCAAGACCTGCAGCTGGCCTTGCAGCCCATG
ATCATCAAACCTTCTGGAAGTGGTGGCGTTCAAATTCTGCAAGAGGCTGTCGGTTGCATGTGTGTAGTGGTACAA
CATCTGACGCATGACTTCATTCGCTTGGTGAACCTTCTCAAGTCTTGTAATGCTCGCCTCCAACAAGCCATCAAA
CGTCCTTCCGCGGCGCAGATGGAGGATAAAGAGACTCGTCCACTGGTGATTCTAATCCTAATCGTCGCCCTACTA
GGGGAACATTGTCAATTTGATCAGCTGAGGGCGGAGAATACAGATATTGCAAAGGAGATCGATGCTATCTCGAAG
GGATCAATCATAGAGCATATCTACGACACTTTATTACAGTTATACCAGAAGTATCATAGCACGCCGATGCTTCGT
GGGAGAACCCTACAGTGTCTTGGCTTCCTATTTCGAGCACAACCCACTTTGATGACCAAGGAGCGCTCCGCTAGT
GTCATGGACGCCATCTTTGCCTCACCGGAAGAAGATGGTAAAGGTCGCTTGCTCAGGATCATGCAAGAATTCTTG
GTGTCAGAGTCTGAAAAGAATTCTGCGAGATTGAAAGAAACGACAAAGGGTAAGTCAAGCAAACCCACCAACATC
AATATGGACGAATTAGTGGGGAACACTGACGGTTTTGCGGACTCTGGTGTCAGTTCTGCCATTGTGCAACGATAT
CTGGATCAAGTTCTCGAAGCTGCCCTCTCCCCTGCATCCACAAATCAGGGTGCTGCTGTGGATGTTCTGAGCTTT
ACAATCAAGCAGGGTTTAGCTCATCCACTCCAATCCTTCCCCGTCATCATTGCGCTCGAGACCAGTCCAGTTACC
AGTCTGAGCAATCGTGCTACCGCTCTACATTCGATCCTCCAAGGAAAGCATGCCTCACTGATCAATACGAGATAC
ATTTTTAGTGCGCGAGCTTCTTTTGAATATCAGAAGAAGATTGCTGGATCTCAGGAAGTGAAAGGTTACCGCACC
GAACCCAGCCCTGTTGCACTGTTACAACGGTGGTTTTCGCTCATCCGAGAGAAGAGAGTCCAGCGTCAAGAGTTC
CTTAAATCTCTGGTCAAAGTATTCCAAGAGAACTCTGATTACCAGTCAACTCAAGACGATGTCGATTTCATGAGG
TACATGGCCGAAAATTTCGCCATGTTCGACTACAAGACTCAAGAAGAGGTTATTACGGTGATAAAGCACCTTACC
GTTGTCTTGTCAACGTCCGGCATGCATCTACTCGAGATGATTTCACCTTCCCATCTGCTAAGTCAACTTCGTGCA
CCATTGGAGACCGCGCAGGAGAGCGCCTCTCAGAAAAATCCTGACACCAATGCCATGGTCGTTGACCCGCCTTCG
GAACCTCAAACTATTTCAATGGTCCCCATTCCAGTTGAAGACAACCTGGACAAGCTTCCTCTAATGCGCACGAGC
GTGATTATTGCCATGGTAATGCTTCTAAAAGCACACCTTAAGTCGCTGTATTCAATATCCGAAGAAAAATGCAAC
AAATTTGTTGTGGGCAAAAAGAGTGCTGCAGGCGACAAACCCGCTACCAGACGAAACGATAAACCTATCTCATGG
AATCGGCTACCCTATGCCACCTCTCCGATGTTGACGACCGAAGACATTCAAGTTCAGAAAGCTAAGTTCCTTGAC
ATTTGGAATGAAGATGGTGTTACAGCTGAACCTGACGACGAACTTGAATTTGCTTGA
Gene >Agabi119p4|099300
ATGGACAACAACCCTCGCTGGCGGCCCCAGGACCAGTACTTCTACCACCAGGAGCCACCCGAGCAGCCCCAGCAG
AACATTCGCTATGGTTCCGCCGCGGCAGACTCTGTTCACCATGCCCAGGGTCTTCTGGCAGTATACCCGATGGCT
TCTGCTACCCCAACAAATCATGGTATTGTCTTGTATCTGGCTTGGTTTGCTTTTGCTGACTTGTGACCAGCCGTG
CGGCATATGAACAACATGTACACTACTGCGGCGCCCCCGACATTTGCTCAGCCGTCGTACTATGCTCCCCGTACT
TCGTATTCGCCCCAAGGGAACCCGCCGCCATATTCGGAGTATGATCATCAAGTTCGATATCTCTCTTCACCTCAA
CCTTCGGTGAATGACGGGGGGTACTGGACTACTGCGCGGGATAATTCTGTCCGCATACTAGCGGATCAACCAGCT
TCGTTAGTCCAGCAGTTTGATCACATATATGCGTCTCATTCTTACTATATGCTCTCAGTTCTTATCGTTATCCCG
CTCAGCAAAACTGGCGTCCTCCACAGGGTCCCGTATCTTCCTTTCAACCGTCACCTTTTGCGCAATCGGTATTTC
AACGCACCGCTCCCCCAAATAATGCGTACCCGACACCTTCACCACCGGTAATGCAGACCTCATCGTCTTCTCTTG
CGCATGCTTTAGGTCCCCCGCCTCATGTGCCACAAAGACTCCCTCCTGATCCGCGACCCCCTCCACCGCAAAAGG
TTTATCGCCCGGAAGAGTCGCGGGCATTTTTCAATACCTTCCTAGAGCAAAAGACTCGAGAAATGCAGATTGCAA
TGCACCCTCGATCTCGCCCTGTAGCCAGTCCATTCAAAACACCTGCTCCAGTAAAGGCGTCTTCTCCTGCGAAAA
CGCCTGTTCCAGTGAGAACGCCTGTCACGAAACTCACTGCTGCCGCACTGAATCAGCCATCCCCCCAATCGAGTC
CTGATCCGTTGTCTATCATGACGTACAGTTCTCCGGTCCCTGTTACTCCTCGTAAGCGAAAGCCAGTCGTTGAAA
TAGAATCTCCGTCTTTGAAGCGTCTGCAGACGATGCGAGATGAGTATGTGCTACCAACGCAGCGCTCCTCCTCTG
CTTCAGCAGCATCTTCTGTTCCTACAACCCCAACTTCCAACTCGGCCGCATCCACTAATTCAAAGGGTCCCACTC
CCACTCCCAAGCGCACTCCAAATTTCGCGTACGTTTCGGTCCCTCGTCCTACCTGGGCGACACCTTATACCCGAC
CGAATGGGTTTACCACACCCTCAATGTCACGCAGAAAATTCAAAATGGACGACCACTCACCTGATCTCGGTGGTT
ATGGTCCCGTGGATGGGGATGGGAGTCCTATCAAACGCCGTAATATAACGGATTCAGCCAAAAGTTCTGTTCGTA
GAACGGGAGACCGCGACGATCGTGGTGAGCCCTTTTCATACTTTCCCCCGCTTGAACGCAAACTGATTCCCTGTT
TAAGCCCCACTCGAAAAGTTTTTATGCTTAATCGAGGATATTTTCGATTCCGAAGACGCCCTACCCGCCGAGATC
AGCATTAGTGACTTACCAGATTATTTTTCATCCCTTTCGCTCGATTCCTCCCAACCGCAGTTGCATTCTAATCAT
ATTCGTAAGCTCACGAAATATATTGGTCAAGTGGCCCGTCCGAACCAGCGACTCCGGAACACAACTGCGGGCGTC
ATGAATACGCCACGGACGCAGGGGCGCATGGCCCAGATTGATACTCAGGTTTTATCGCGATTGCTCAAGGTTTTG
GATCGATCTGTCAAAACCGGCGAGGATTTGGATCCCTTCAAATATGTCGCACCGTCGGCAGGACCTCCTAAGAGC
TCTCCTCGGAAAAAAGCCGCGAAAGCCAAGAAACCAGATACTTCTCAATCACAGATGGTTAAAGGAGGTTCGGAT
GATACCACTGGTCAAGATACTGATCGCAGAAGTACTGAAGAAGAAGATCGTGAGCCTGAAATGGAGCTGACCAGC
GTGGATCATAAACAATTGACGCGGTCCTTAAACATCGCTCGAGAGAGCATTTTGGCTGCCGATTGCTGTATTGCG
TTGCTTGGAAGCGACAGGCTGACCAAACAGGTACGTGGCGACATATCTAAGCGGCACAACTGTTGACAAGTTTTC
TCAGTTATATTCTGAAGAGCTGATCATTTCTTGCTTTAATGCCGTTAAAAACCAACTTGAGAAGGTCATTTATCC
ATTTGTAGAGACGTCAACAGGAATGGCTTTCGAATTTGGCGGTAATCCAATGCTCCGTTTTATCGTTCAAGACAA
CTCCTCGACTGCATCGTCTCATCGGAAGCAACTGAGCGAGTTGTTCCAGGCCTTGTCCAGCGTTATCCCGCGCAT
CAACAATCTTCTGAATGCTGAAACTGTTGCGATGTCGGATACGATTATCATTTCCGCGGTATACATTGCAATAGG
ACCATTTTTCGTCGTTGAAGGGGAAGGTGAATCGAAAGGCAAAAAAGAAAAAGACAACGTCATTTTGAAAACTTT
TGGTAAGAGTGCTATGAGGGGTCTGCGCTTAGATGCCTTGGGTTTGATCAGGAGTGTTAGTCTTTCGCCTTTCTC
TCTTTATCTCTCTCAAAGCTTGCGTATTGATCTGATCAATTTTTTTGATGCAGATCTTCGCTAATAATGAGAGCC
AACGGTCATGGATTATCGAGGAGATTCTGACTTCATTAATCAAGCTATCAGATACGAAGCAGAAAGCCGGTTCAT
TCCGGTAAGTCATGCATAGCTTGAGTAGGTCTCGATTACTGATCAGAGTTTAGACTCCGCGATGGTCGATCTATA
CGAACGGTTTCTGCCTTGTTGTTGCAACTCGTTCAAACCTCAGCGCATGACGTACGACTGAAAGCGAGAAAAATA
GAGAAGAACAGACAGAACCAGTTGGCTTTGAAACGCCAAGAAAGCTTTTCGGAAAGTCAACAAGCACAGGAACCT
TTTCTGGATGAGAATGACCATGAGGTGAGCGTACATTACAGATGATCGAGCGAATGTAATGTTTTGTTTCATGCA
GGAAATTGTGCTTTACAAAGGAGGCTTGGATTCGGCGATGCAAGCTGCGAAAACCATTATCGGCTTTTTGACTAA
ACGCTCGGGCAAAGGCAAGACAACGAAAAATTCAAATGAGGCGGAGTATCGCGCTATCTTCGATAACCTGATCGG
TGATCTTCTGGTTGTGCTCTTCTGGCCGGAATGGCCAGCCGCCGGAGTTTTGTTGACTATGATCTGTCGATACAT
GGTGAGTCCAGTGTTCATTTTTCTCGTGCGGCATTAACTGAACATTGGTGGTACGCGCTAGGTCAACGCGCTGAG
CGACAAACATGTGAATGCACAGATTGATTCGAATGCAGCCAAGACGATGGCGCTCGATCATCTTGGTGTCATTGC
TGCCAGAATACGATCCGCAACGCTCAAGTACCAAGTGAAAGTGGATGAAGAAGCCAAAGTCCGACCATTGAGATC
AATAGATGAGGTAAGTGCTTGAGGGATTCCCTGACGCTGGTCTCTTACCCTTTCGGCCCTAAGATCGTAGATGGA
CAAGATATCAAGGCATTTGAGCGCTTGTTGAAGGCCCACAGAGACGTCATGGCTCATATCGCTAGGCGGTCTTCC
GAAGACCAAGCATACGATGTAAGTCTGCGTGGTCTCTGTCCAGATGGACAAAATGTTGATAGCATTTTCTAAACT
TTATTAATATAGAGTGCACGGGAGCTATCGGCAGCAATCCTAGGACAGGAACTTGCTACTGCACTTCAGCAACTG
CAGAAGTGGATCGAGATGCCCGAGTTGGATGATGATCTCGATCTTAAGGATCCTCGGGATACCAATAAGATGCTC
ACCTTTGGCCGCAAAGTTAGGGGTGCATTAAGGGACGTCTGGAAAGATCCTCCTACGGACGTATTCGATGTTGGG
TAAGGAAGCCTCTTCCCATTTTCCGAAATCTTGCGTTGAGAATGTCTTTTTAAGGTCACAAGAAGAAGTAGATCG
GATTGATCAACTTGGAGAACAGATTGGGACACTTCAAGCCATGCGCAGCTCCTTTGACCCAATTCTGAACACTAT
CGTCGCATCGCTGAATGCGCCAGTCATTTTTATCCGTACGAAGGCACTTCGTGCCCTTGGACAGATCGTCACCAG
CGATCCCGTCGTGTTGTCCATGGTGAGTTGAATTTCTTTTGGCAAGCTTAGTGTTTGCTCACGTGCACCTTTAAG
CCAATCGTTCGTCGTGGCATAGAAAACCACCTGCTTGATAGTTCACCTGCCGTTCGAGATGCCGCAGTTGAGCTG
ATTGGCAAGTACATGATTGACTCGCCGGAGGTGGCGGGGAACTATTATCAGAAAATCGCTGACCGAATGGCCGTG
AGTGTTATCTAGGTATCTTCTAGGTGGAAGTTAACGTTCTCCCTCCAGGACACTGGTCTTGGTGTGCGAAAACGC
GTGATAAAGCTCCTTAAATCATTTTACAGTGTCACTCAAGACAACAACTGCAAGATTGATATCGCAACTCGGATG
GTTGCCCGGATGATGGATGAAGATGATACAGTGAAAGAGCTCGCCATCAAAACCATTGAAGAGTTATGGTTTCCC
ACTGTGCCCACCACAACAGTCAATACCCGGACCAAGTCCGCCCCCGCTGACCACAATCAGAGTGACAAGAATTCA
ATCCTTGCGAAAGTGATTGTAATAATGGGCACGGCCGCTCAATTTAAGGAGCGACAGTCGCCACTTGAGGACTTA
TTACACAAGATTATGGCCGAAAAGCCGGAGAACGAGGTTCCAGCTCTCCATGCTCGATATTCAGAAATTTGCGAG
ACGTTGATAGATGGATTAGTGGATGCTACGGACATGCCGGGATTTGTAAGCACTCATTTTCTGCCGTCAATATTT
CCGGACTAATAGTAGGATTGCTTGAAAGACGGTTGTCAACTGCATACGGACTATCTACTTGTTCACTTCGGCATA
CCCACCAGTGCTCTCTGGTTCAAATGCGTCGACATTGCTTCCGTACCTCAAAAGCACTTCATCGGTGAGTGTATA
TGGTGCCTTTGTGATAATTTTGGCTGACAATCGATTGCAGAATGAGGAGTTAATAACGACCGATTATCTACTCAA
AGTTTTCCGGGTATCGATTCCCCACATGTCACCAACGGCAGGCAAGTTTGGGCAAGACCTGCAGCTGGCCTTGCA
GCCCATGATCATCAAACCTTCTGGAAGTGGTGGCGTTCAAGTAGGTTTCGAATACTTGCAAGGATGGTTTGAACT
GTCGCTAACATTGGCTTAGATTCTGCAAGAGGCTGTCGGTTGCATGTGTGTAGTGGTACAACATCTGACGCATGA
CTTCATTCGCTTGGTGAACCTTCTCAAGTCTTGTAATGGTAATCGTCTGTCAATGACTTTGAAGATTTTTCGCTG
AATTACTTTTAGCTCGCCTCCAACAAGCCATCAAACGTCCTTCCGCGGCGCAGATGGAGGATAAAGAGACTCGTC
CACTGGTGATTCTAATCCTAATCGTCGCCCTACTAGGGGAACATTGTCAATTTGATCAGCTGAGGGCGGAGAATA
CAGGTACGCTTCGTATCACGCCACCTGTGTTCTATCCTAATTATTTCTACAGATATTGCAAAGGAGATCGATGCT
ATCTCGAAGGTCAGTTTTCTAACTTTGCATGTATGCAAATAATTAACGGAGTCTGTAGGGATCAATCATAGAGCA
TATCTACGACACTTTATTACAGTTATACCAGAAGTATCATAGCACGCCGATGCTTCGTGGGAGAACCCTACAGTG
TCTTGGTACGTTCACACAATGTCAATCACGTACTGCTTGTTCACTTAGTCTTCTGTGTACAGGCTTCCTATTTCG
AGCACAACCCACTTTGATGACCAAGGAGCGCTCCGCTAGTGTCATGGACGCCATCTTTGCCTCACCGGAAGAAGA
TGGTAAAGGTCGCTTGCTCAGGATCATGCAAGAATTCTTGGTGTCAGAGTCTGAAAAGAATTCTGCGAGATTGAA
AGGTGCGCCCAAGTTATAATCTCTTGTGCTTCATACCCTTATACGCTTTTCATCTATAAGAAACGACAAAGGGTA
AGTCAAGCAAACCCACCAACATCAATATGGACGAATTAGTGGGGAACACTGACGGTTTTGCGGACTCTGGGTACG
TGGTGACAACTTACCTTAGTATCAGAACCTCATCGTCTCTTGCAGTGTCAGTTCTGCCATTGTGCAACGATATCT
GGATCAAGTTCTCGAAGCTGCCCTCTCCCCTGCATCCACAAATCAGGGTGCTGCTGTGGATGTTCTGAGCTTTAC
AATCAAGCAGGGTTTAGCTCATCCACTCCAATCCTTCCCCGTCATCATTGCGCTCGAGACCAGTCCAGTTACCAG
TCTGAGCAATCGTGCTACCGCTCTACATTCGATCCTCCAAGGAAAGCATGCCTCACTGATCAATACGAGATACAT
TTTTAGTGCGCGAGCTTCTTTTGAATATCAGAAGAAGATTGCTGGATCTCAGGAAGTGAAAGGTCAGTTGCTAAT
AATACAATATGTCCTTTTTGGGTGAGACTCAATCATCTAAGGTTACCGCACCGAACCCAGCCCTGTTGCACTGTT
ACAACGGTGGTTTTCGCTCATCCGAGAGAAGAGAGTCCAGCGTCAAGAGTTCCTTAAATCTCTGGTCAAAGTATT
CCAAGAGAACTCTGATTACCAGTCAACTCAAGTGAGTTTACCTGCCCGTGTGACACGATATAAGCTTTGACATAG
GAACAAGGACGATGTCGATTTCATGAGGTACATGGCCGAAAATTTCGCCATGTTCGACTACAAGACTCAAGAAGA
GGTTATTACGGTGATAAAGCACCTTACCGTTGTCTTGTCAACGTCCGGCATGCATCTACTCGAGATGATTTCACC
TTCCCATCTGCTAAGTCAACTTCGTGCACCATTGGAGACCGCGCAGGAGAGCGCCTCTCAGAAAAATCCTGACAC
CGTGCGTTGAAACTCACAAATAGCTGCTGTAGGTGTTCTCACCTTCATGTTACAGAATGCCATGGTCGTTGACCC
GCCTTCGGAACCTCAAACTATTTCAATGGTCCCCATTCCAGTTGAAGACAACCTGGACAAGCTTCCTCTAATGCG
CACGAGCGTGATTATTGCCATGGTAATGCTTCTAAAAGCACACCTTAAGTCGCTGTATTCAATATCCGAAGAGTA
TGTTAGCGTTTAACTGTTGTTTCCGTGAGCTTATCCTCTTGACAGAAAATGCAACAAATTTGTTGTGGGCAAAAA
GAGTGCTGCAGGCGACAAACCCGCTACCAGACGAAACGATAAACCTATCTCATGGAATCGGCTACCCTATGCCAC
CTCTCCGATGTTGACGACCGAAGACATTCAAGTTCAGAAAGCTAAGGTAAGCTGAATGCGCTCTCGAGCACTCCA
TTCGGACTAACGATCACTCTAGTTCCTTGACATTTGGAATGAAGATGGTGTTACAGCTGAACCTGACGACGAACT
TGAATTTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail