Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|099260
Gene name
Locationscaffold_07:540371..541081
Strand+
Gene length (bp)710
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 43 139 1.0E-10
sp|Q55G31|EXPL1_DICDI Expansin-like protein 1 OS=Dictyostelium discoideum GN=expl1 PE=2 SV=1 54 137 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|099260
MMFFRAACTVLATLGLILSALGAPAPTVDTIDAVHLEKRITHTGRGTWFHVGLGNCGKWNKDSDYIVAISKDLYD
NNKASNCDQYVEITNTDNGRTIHALTRDSCPSCGYYDLDLSPDAFKALAPLDQGVMKKMKWHFMNRNWHP*
Coding >Agabi119p4|099260
ATGATGTTCTTCCGCGCCGCCTGCACTGTCTTAGCCACGCTTGGGTTGATCTTGTCAGCCTTGGGAGCGCCCGCA
CCTACTGTCGACACCATAGACGCAGTCCACCTAGAAAAAAGGATTACGCACACCGGAAGGGGAACATGGTTTCAT
GTTGGCCTAGGAAACTGTGGCAAATGGAACAAAGACTCCGACTACATCGTTGCCATATCTAAGGATCTTTACGAC
AACAACAAAGCTAGTAATTGCGATCAGTATGTGGAAATCACGAACACAGACAATGGCCGTACTATACATGCCCTT
ACACGGGACAGTTGTCCTAGCTGTGGATATTACGACCTCGATTTATCCCCTGACGCATTCAAAGCCTTGGCCCCC
CTTGATCAGGGTGTGATGAAAAAAATGAAATGGCATTTCATGAACAGGAATTGGCATCCTTGA
Transcript >Agabi119p4|099260
ATGATGTTCTTCCGCGCCGCCTGCACTGTCTTAGCCACGCTTGGGTTGATCTTGTCAGCCTTGGGAGCGCCCGCA
CCTACTGTCGACACCATAGACGCAGTCCACCTAGAAAAAAGGATTACGCACACCGGAAGGGGAACATGGTTTCAT
GTTGGCCTAGGAAACTGTGGCAAATGGAACAAAGACTCCGACTACATCGTTGCCATATCTAAGGATCTTTACGAC
AACAACAAAGCTAGTAATTGCGATCAGTATGTGGAAATCACGAACACAGACAATGGCCGTACTATACATGCCCTT
ACACGGGACAGTTGTCCTAGCTGTGGATATTACGACCTCGATTTATCCCCTGACGCATTCAAAGCCTTGGCCCCC
CTTGATCAGGGTGTGATGAAAAAAATGAAATGGCATTTCATGAACAGGAATTGGCATCCTTGA
Gene >Agabi119p4|099260
ATGATGTTCTTCCGCGCCGCCTGCACTGTCTTAGCCACGCTTGGGTTGATCTTGTCAGCCTTGGGAGCGCCCGCA
CCTACTGTCGACACCATAGACGCAGTCCACCTAGAAAAAAGGATTACGCACACCGGAAGGGTAAGTTCATTCTTT
TGTCCTTCGTCACAATGATCATTTTCTAACGTTGTCATATTTAGGGAACATGGTTTCATGTTGGTAAGCCTAATA
AAAGATGTCATTGCCTCCAGCATTGTAATAATGCTGTTCTTCGCGAAATTAGGCCTAGGAAACTGTGGCAAATGG
AACAAAGACTCCGACTACATCGTTGCCATATCTAAGGATCTTTACGACAACAACAAAGCTAGTAATTGCGATCAG
GTAAGAACTGCCGCTTTCGGATTTCTATATTTAACCTCGGCATGCTGACAACATGTTTTCCTTTCGTATTTTTAG
TATGTGGAAATCACGAACACAGACAATGGCCGTACTATACATGCCCTTACACGGGACAGTTGTCCTAGCTGTGGA
TATTACGACCTCGGTACGCTTGTTTTTCGGCTACAGACGTGTCCATTCATTTCTCATGGTGTAAACTGGCGTATT
CTCATGTTACAGATTTATCCCCTGACGCATTCAAAGCCTTGGCCCCCCTTGATCAGGGTGTGATGAAAAAAATGA
AATGGCATTTCATGAACAGGAATTGGCATCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail