Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|097890
Gene name
Locationscaffold_07:188716..192642
Strand-
Gene length (bp)3926
Transcript length (bp)3627
Coding sequence length (bp)3627
Protein length (aa) 1209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.7E-12 1135 1178
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 4.2E-09 1135 1177
PF17123 zf-RING_11 RING-like zinc finger 1.6E-08 1136 1163
PF12678 zf-rbx1 RING-H2 zinc finger domain 6.8E-08 1131 1178
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 4.8E-08 1136 1177
PF14634 zf-RING_5 zinc-RING finger domain 1.5E-06 1135 1179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87237|YC0C_SCHPO Uncharacterized RING finger protein C4G3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4G3.12c PE=3 SV=1 1057 1184 4.0E-21
sp|Q9P7E1|YOF7_SCHPO Uncharacterized RING finger protein P4H10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.07 PE=1 SV=1 1055 1187 1.0E-18
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 1080 1179 2.0E-13
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 1080 1179 3.0E-12
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 1080 1179 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87237|YC0C_SCHPO Uncharacterized RING finger protein C4G3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4G3.12c PE=3 SV=1 1057 1184 4.0E-21
sp|Q9P7E1|YOF7_SCHPO Uncharacterized RING finger protein P4H10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.07 PE=1 SV=1 1055 1187 1.0E-18
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 1080 1179 2.0E-13
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 1080 1179 3.0E-12
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 1080 1179 5.0E-12
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 1136 1208 7.0E-12
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 1080 1179 7.0E-12
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 1080 1179 1.0E-11
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 1080 1179 2.0E-11
sp|Q7XTV7|HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica GN=HIP1 PE=1 SV=2 1078 1184 6.0E-11
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 1136 1208 2.0E-10
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 1136 1208 2.0E-10
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 1136 1208 5.0E-10
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 1131 1182 9.0E-10
sp|Q9ZU51|RHA2B_ARATH Probable E3 ubiquitin-protein ligase RHA2B OS=Arabidopsis thaliana GN=RHA2B PE=1 SV=2 1127 1179 1.0E-09
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 1136 1178 2.0E-09
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 1136 1178 2.0E-09
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 1136 1208 2.0E-09
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 1136 1186 2.0E-09
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 1136 1178 3.0E-09
sp|Q4R6Y5|ZNRF4_MACFA Zinc/RING finger protein 4 OS=Macaca fascicularis GN=ZNRF4 PE=2 SV=1 1086 1193 3.0E-09
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 1136 1208 3.0E-09
sp|E9QAU8|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1 1054 1178 3.0E-09
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 1136 1178 4.0E-09
sp|Q9ZQF9|MBR1_ARATH E3 ubiquitin-protein ligase MBR1 OS=Arabidopsis thaliana GN=MBR1 PE=1 SV=1 1078 1184 5.0E-09
sp|Q6ZSG1|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1 1054 1178 5.0E-09
sp|P93823|ATL1_ARATH RING-H2 finger protein ATL1 OS=Arabidopsis thaliana GN=ATL1 PE=2 SV=1 1134 1195 5.0E-09
sp|O49500|MBR2_ARATH E3 ubiquitin-protein ligase MBR2 OS=Arabidopsis thaliana GN=MBR2 PE=1 SV=1 1078 1184 5.0E-09
sp|Q8LFY8|ATL54_ARATH RING-H2 finger protein ATL54 OS=Arabidopsis thaliana GN=ATL54 PE=2 SV=2 1106 1189 6.0E-09
sp|Q8WWF5|ZNRF4_HUMAN Zinc/RING finger protein 4 OS=Homo sapiens GN=ZNRF4 PE=2 SV=3 1134 1193 8.0E-09
sp|Q5R476|RN111_PONAB E3 ubiquitin-protein ligase Arkadia OS=Pongo abelii GN=RNF111 PE=2 SV=1 1083 1178 8.0E-09
sp|Q9SRQ8|ATL51_ARATH RING-H2 finger protein ATL51 OS=Arabidopsis thaliana GN=ATL51 PE=2 SV=2 1136 1199 1.0E-08
sp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana GN=ATL55 PE=1 SV=1 1136 1179 1.0E-08
sp|Q9FL07|ATL46_ARATH RING-H2 finger protein ATL46 OS=Arabidopsis thaliana GN=ATL46 PE=2 SV=1 1136 1180 1.0E-08
sp|Q9ZT50|RHA2A_ARATH E3 ubiquitin-protein ligase RHA2A OS=Arabidopsis thaliana GN=RHA2A PE=1 SV=1 1136 1193 2.0E-08
sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 1082 1178 2.0E-08
sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1 1083 1178 2.0E-08
sp|Q99ML9|RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus GN=Rnf111 PE=1 SV=1 1083 1178 2.0E-08
sp|Q9LSW9|ATL16_ARATH RING-H2 finger protein ATL16 OS=Arabidopsis thaliana GN=ATL16 PE=2 SV=1 1134 1186 3.0E-08
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 1136 1178 3.0E-08
sp|Q6ZNA4|RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens GN=RNF111 PE=1 SV=3 1083 1178 3.0E-08
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 1110 1180 3.0E-08
sp|Q6NRV8|R111B_XENLA E3 ubiquitin-protein ligase arkadia-B OS=Xenopus laevis GN=rnf111-b PE=2 SV=1 1083 1178 3.0E-08
sp|Q9LF64|ATL52_ARATH RING-H2 finger protein ATL52 OS=Arabidopsis thaliana GN=ATL52 PE=2 SV=1 1136 1200 3.0E-08
sp|Q9SLC4|ATL40_ARATH RING-H2 finger protein ATL40 OS=Arabidopsis thaliana GN=ATL40 PE=2 SV=1 1136 1179 4.0E-08
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 1136 1178 4.0E-08
sp|Q8SV35|Y733_ENCCU Uncharacterized RING finger protein ECU07_0330 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0330 PE=3 SV=2 1079 1179 5.0E-08
sp|P87119|MU145_SCHPO RING finger protein mug145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug145 PE=1 SV=1 1136 1177 5.0E-08
sp|Q9FHG8|ATL50_ARATH Putative RING-H2 finger protein ATL50 OS=Arabidopsis thaliana GN=ATL50 PE=3 SV=1 1136 1193 7.0E-08
sp|Q0V9R0|RN111_XENTR E3 ubiquitin-protein ligase arkadia OS=Xenopus tropicalis GN=rnf111 PE=2 SV=1 1082 1178 7.0E-08
sp|Q9LZJ6|ATL5_ARATH RING-H2 finger protein ATL5 OS=Arabidopsis thaliana GN=ATL5 PE=2 SV=1 1133 1179 8.0E-08
sp|Q8N7C7|RN148_HUMAN RING finger protein 148 OS=Homo sapiens GN=RNF148 PE=2 SV=2 1096 1178 1.0E-07
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 1082 1178 1.0E-07
sp|Q8L9T5|ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana GN=ATL2 PE=2 SV=2 1092 1208 1.0E-07
sp|Q2TA44|RN148_BOVIN RING finger protein 148 OS=Bos taurus GN=RNF148 PE=2 SV=1 1095 1178 1.0E-07
sp|Q8LGA5|ATL31_ARATH E3 ubiquitin-protein ligase ATL31 OS=Arabidopsis thaliana GN=ATL31 PE=1 SV=2 1124 1208 1.0E-07
sp|Q9ZT49|ATL45_ARATH RING-H2 finger protein ATL45 OS=Arabidopsis thaliana GN=ATL45 PE=2 SV=1 1136 1182 1.0E-07
sp|Q6NKR1|ATL28_ARATH RING-H2 finger protein ATL28 OS=Arabidopsis thaliana GN=ATL28 PE=2 SV=1 1107 1179 2.0E-07
sp|Q68DV7|RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 OS=Homo sapiens GN=RNF43 PE=1 SV=1 1136 1177 2.0E-07
sp|Q9ZV53|ATL49_ARATH Putative RING-H2 finger protein ATL49 OS=Arabidopsis thaliana GN=ATL49 PE=3 SV=1 1136 1187 2.0E-07
sp|Q940Q4|ATL13_ARATH RING-H2 finger protein ATL13 OS=Arabidopsis thaliana GN=ATL13 PE=2 SV=2 1136 1178 2.0E-07
sp|Q5NCP0|RNF43_MOUSE E3 ubiquitin-protein ligase RNF43 OS=Mus musculus GN=Rnf43 PE=2 SV=1 1136 1190 2.0E-07
sp|O22255|ATL64_ARATH RING-H2 finger protein ATL64 OS=Arabidopsis thaliana GN=ATL64 PE=2 SV=1 1136 1179 2.0E-07
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 1134 1178 3.0E-07
sp|G3X9R7|RN148_MOUSE RING finger protein 148 OS=Mus musculus GN=Rnf148 PE=2 SV=1 1096 1178 3.0E-07
sp|Q8BP31|RN122_MOUSE RING finger protein 122 OS=Mus musculus GN=Rnf122 PE=2 SV=1 1134 1190 3.0E-07
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 1082 1203 3.0E-07
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 1117 1178 4.0E-07
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 1133 1178 5.0E-07
sp|Q9SG96|ATL72_ARATH RING-H2 finger protein ATL72 OS=Arabidopsis thaliana GN=ATL72 PE=2 SV=1 1136 1180 6.0E-07
sp|Q8TEB7|RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens GN=RNF128 PE=1 SV=1 1035 1179 7.0E-07
sp|Q8GYT9|SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana GN=SIS3 PE=2 SV=2 1124 1198 7.0E-07
sp|Q7ZW78|RN181_DANRE E3 ubiquitin-protein ligase RNF181 OS=Danio rerio GN=rnf181 PE=2 SV=2 1135 1178 7.0E-07
sp|Q9Y225|RNF24_HUMAN RING finger protein 24 OS=Homo sapiens GN=RNF24 PE=1 SV=1 1124 1177 7.0E-07
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 1136 1178 7.0E-07
sp|Q8BGI1|RNF24_MOUSE RING finger protein 24 OS=Mus musculus GN=Rnf24 PE=2 SV=1 1124 1177 7.0E-07
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 1085 1178 8.0E-07
sp|Q29RU0|RN128_BOVIN E3 ubiquitin-protein ligase RNF128 OS=Bos taurus GN=RNF128 PE=2 SV=1 1035 1179 8.0E-07
sp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana GN=ATL15 PE=1 SV=1 1136 1191 8.0E-07
sp|Q9SLC3|ATL41_ARATH E3 ubiquitin-protein ligase ATL41 OS=Arabidopsis thaliana GN=ATL41 PE=1 SV=1 1136 1179 8.0E-07
sp|P0CH30|RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum GN=RING1 PE=1 SV=1 1101 1178 9.0E-07
sp|Q9SL78|ATL12_ARATH Putative RING-H2 finger protein ATL12 OS=Arabidopsis thaliana GN=ATL12 PE=3 SV=1 1136 1179 9.0E-07
sp|Q9H9V4|RN122_HUMAN RING finger protein 122 OS=Homo sapiens GN=RNF122 PE=2 SV=2 1134 1191 9.0E-07
sp|P0C034|ATL10_ARATH RING-H2 finger protein ATL10 OS=Arabidopsis thaliana GN=ATL10 PE=2 SV=1 1134 1200 1.0E-06
sp|Q9SJJ7|ATL57_ARATH RING-H2 finger protein ATL57 OS=Arabidopsis thaliana GN=ATL57 PE=2 SV=1 1134 1184 1.0E-06
sp|Q9LY41|ATL4_ARATH E3 ubiquitin-protein ligase ATL4 OS=Arabidopsis thaliana GN=ATL4 PE=1 SV=1 1136 1186 1.0E-06
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 1083 1203 1.0E-06
sp|Q9LT17|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1 1134 1190 1.0E-06
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 1134 1178 1.0E-06
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 1134 1178 1.0E-06
sp|Q9D304|RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus GN=Rnf128 PE=1 SV=1 1035 1179 1.0E-06
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 1134 1178 2.0E-06
sp|F4HZZ5|RMR5_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 5 OS=Arabidopsis thaliana GN=RMR5 PE=2 SV=1 1110 1206 2.0E-06
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 1134 1178 2.0E-06
sp|Q8GW38|ATL47_ARATH RING-H2 finger protein ATL47 OS=Arabidopsis thaliana GN=ATL47 PE=2 SV=1 1136 1180 2.0E-06
sp|Q5RF74|RN128_PONAB E3 ubiquitin-protein ligase RNF128 OS=Pongo abelii GN=RNF128 PE=2 SV=1 1035 1179 2.0E-06
sp|Q8LC69|ATL8_ARATH RING-H2 finger protein ATL8 OS=Arabidopsis thaliana GN=ATL8 PE=2 SV=2 1136 1184 2.0E-06
sp|Q5XF85|ATL42_ARATH E3 ubiquitin-protein ligase ATL42 OS=Arabidopsis thaliana GN=ATL42 PE=1 SV=2 1136 1178 2.0E-06
sp|Q9FLC6|ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana GN=ATL73 PE=2 SV=1 1106 1180 2.0E-06
sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 1134 1178 2.0E-06
sp|Q9SZL4|ATL18_ARATH RING-H2 finger protein ATL18 OS=Arabidopsis thaliana GN=ATL18 PE=2 SV=1 1121 1199 2.0E-06
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 1101 1178 3.0E-06
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 1136 1186 3.0E-06
sp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2 1136 1179 4.0E-06
sp|Q9FGJ6|ATL79_ARATH RING-H2 finger protein ATL79 OS=Arabidopsis thaliana GN=ATL79 PE=2 SV=1 1136 1180 4.0E-06
sp|Q7XLY8|ATL41_ORYSJ E3 ubiquitin-protein ligase Os04g0590900 OS=Oryza sativa subsp. japonica GN=Os04g0590900 PE=2 SV=2 1136 1179 4.0E-06
sp|Q9FG21|ATL71_ARATH Putative RING-H2 finger protein ATL71 OS=Arabidopsis thaliana GN=ATL71 PE=3 SV=1 1106 1180 4.0E-06
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 1130 1184 5.0E-06
sp|Q95K04|RN133_MACFA E3 ubiquitin-protein ligase RNF133 OS=Macaca fascicularis GN=RNF133 PE=2 SV=1 1123 1178 6.0E-06
sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 1134 1191 6.0E-06
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 1114 1178 6.0E-06
sp|Q94BY6|ATL75_ARATH RING-H2 finger protein ATL75 OS=Arabidopsis thaliana GN=ATL75 PE=2 SV=1 1134 1208 6.0E-06
sp|Q9LM69|ATL80_ARATH RING-H2 finger protein ATL80 OS=Arabidopsis thaliana GN=ATL80 PE=2 SV=1 1136 1184 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|097890
MGQSSSRPRNPLRHFLGRRRDADKDNTNDDDDDGPQPGPLPPQPSVPPPLPPPSPPPPSPPPPPPPPPPAPPTPP
RQFPPPGTLVVVQGIVHTTDVSRANPNTGDTVVDSDIHRNNGSSSVPASPSSSASIARDRLLSLLGRRASTPATG
ENLDTEDDAPAVLSDGSPDHFHPSPQPQSPRVRRGTAHSATARGPSYQQRGQQRQNEDRSAISSNSIDVLGTLLS
VAAAATAASLLTGSSEPILSSGLAPPPPATSSTSNAFAPSPPPTSDISPTPALQPVSRPVPQHTPSPSALEVPPE
RRDGGNGQQEQTQPLSSTSTTMFNDRRVVERRRTTWNMLRERLRLRARDTVESSPSSQPPQLPPPPPPPPRPQQH
LEPTSRTSPHASPFIPPPPSSSSTPEHERGGRERERYRPGFSSPSLPPSLSASTSTNTTTPTTTSSSSSSSPPTA
MSMPTLTDTREQMLAEMARAFNLGLGLNGGGSGGSGSVFGGFSPHHGNNTQGQTGGGDADNEGRGRELPPEGSFE
RFLVELQADLRVVLSLDSRSEEEEERGDRARNENETEQEEEVTTGRRARGLSVGSLVPTEPAESVHSVEDPNMPA
LQDVTDDDSSNGQTELSDDDDDDFLSATTSTPVLAPTLSSEEPSRGLELPRIPRPVLEVVEDEEEESEAVEVSPT
TTTATTTTIPNEPTTAPPAPATTANEGVTTGGGTNGFDASGRLNWWRAYRFPAVASAGATHAGGGGADGVPAAAR
TRSGPFATATATATGSSSRTGIPATSSSDVIPPFSPLSTFSSSMDPSSHTHHQDNTTSPTNTTPPPASHSTTSAT
TTNVNETTANSNSVVPVIIVGLQSVNAPNWRPLMGLEGDDLWDHNHPHPHHHQHHHHNPHLRFNHNHNHSRLDRH
RRRRSGFSDLIHRREEGEEEDMFVMREEEEENEDEDEDDDGNEDEIGREREEEMMMGIDDLHIEDDDGSSFYETH
SRGPRRLRERERERERRGWRNAFGGLRSGAGSSGSGSGSGSFGREGQSASSSGGEGGYNRREQSATMNVPPSPMG
GPGSRTFLIYVIGGYYPPDHSIVTGGPDNLESFEALLELVEMLGSAKASTASKDDIEKSGLEVIKRSQLEMYERE
KKVSSNCVERCLICLDEYEEEDEIRVMNCRHAFHRGCVDTWLQTGKNNCPACRSTGVASTSTSTSSTTQAQAQTA
AVPPQPLV*
Coding >Agabi119p4|097890
ATGGGCCAGTCTTCGTCCCGTCCACGCAACCCGCTCAGGCACTTTCTCGGGCGCAGGAGAGACGCTGACAAAGAC
AACACCAACGACGACGACGACGACGGCCCGCAACCTGGCCCGCTCCCGCCTCAGCCCTCCGTCCCGCCCCCGCTG
CCCCCGCCGTCGCCGCCACCGCCATCCCCACCACCGCCGCCACCACCGCCGCCACCAGCACCACCAACACCACCA
CGTCAATTTCCTCCACCCGGCACTCTCGTCGTCGTTCAGGGCATCGTCCACACCACCGACGTCTCCCGCGCCAAT
CCCAACACTGGCGATACCGTCGTCGACAGTGATATCCATCGGAACAACGGATCGTCATCAGTTCCTGCATCTCCC
TCTTCTTCAGCATCGATTGCTAGAGATCGACTTTTGTCGCTGCTCGGACGACGGGCATCCACACCTGCCACGGGT
GAAAATTTAGACACCGAAGACGATGCTCCAGCTGTACTTTCGGATGGCAGTCCTGATCACTTTCATCCGTCTCCG
CAACCGCAGTCGCCACGAGTACGACGTGGAACCGCTCATTCCGCCACTGCACGAGGGCCATCATATCAACAACGT
GGTCAGCAGCGTCAAAATGAGGACCGATCGGCTATTTCATCAAATAGTATCGACGTTCTTGGAACCTTACTCAGT
GTTGCTGCTGCTGCTACTGCCGCTTCTTTACTGACGGGATCGTCGGAACCTATCTTATCTTCCGGATTGGCGCCG
CCTCCACCTGCTACTAGTTCCACTTCGAATGCGTTCGCTCCTTCCCCGCCCCCCACTTCCGATATTTCGCCTACA
CCCGCACTACAACCGGTATCACGTCCAGTACCCCAACATACCCCATCGCCATCAGCTTTGGAGGTGCCACCTGAA
CGGCGCGATGGCGGTAACGGACAACAGGAACAAACACAACCGTTATCATCAACGTCAACGACGATGTTCAATGAT
CGGAGAGTTGTTGAAAGAAGACGGACTACTTGGAATATGTTGAGAGAGAGGCTGAGGTTACGTGCGAGAGATACT
GTGGAATCATCACCTTCGTCACAACCACCGCAATTACCACCGCCGCCACCGCCACCGCCACGACCTCAACAACAC
CTCGAGCCTACGTCGAGGACATCGCCCCACGCATCACCATTTATTCCTCCCCCACCGTCATCGTCATCTACCCCA
GAACATGAAAGGGGAGGACGTGAACGCGAACGATACAGACCTGGATTCTCATCACCTTCATTACCTCCTTCTCTA
TCAGCATCAACATCCACGAATACAACCACACCAACAACAACATCCTCATCTTCATCCTCATCACCTCCAACGGCT
ATGTCTATGCCTACGTTGACGGATACAAGAGAACAAATGTTGGCCGAGATGGCTAGAGCATTTAATCTCGGATTG
GGATTAAACGGTGGCGGAAGTGGTGGTAGTGGGAGCGTGTTTGGTGGATTCAGTCCTCACCATGGTAATAATACT
CAAGGACAAACAGGGGGCGGGGATGCTGATAATGAGGGAAGAGGGAGGGAGTTACCGCCTGAAGGATCTTTTGAA
CGGTTTTTGGTGGAGTTGCAGGCGGATTTGAGAGTGGTGTTGAGTTTGGATTCGAGGAGTGAGGAGGAGGAGGAG
AGGGGAGATCGAGCGAGGAATGAGAATGAGACTGAACAAGAAGAGGAGGTTACGACGGGGAGGAGAGCTAGGGGA
CTTTCGGTTGGGTCTTTGGTACCTACCGAACCTGCTGAGAGTGTTCATTCCGTGGAGGATCCGAATATGCCTGCT
TTACAAGATGTTACGGATGATGACTCTTCGAATGGTCAAACTGAATTGAGCGATGATGATGACGACGACTTTTTG
TCGGCTACGACATCCACACCGGTTTTGGCTCCTACTTTATCATCTGAAGAACCGAGTCGTGGTTTGGAATTACCG
AGGATTCCGAGACCTGTTTTGGAAGTTGTTGAAGATGAGGAAGAGGAAAGTGAAGCCGTAGAAGTCTCGCCTACA
ACCACAACAGCAACGACGACGACGATTCCTAATGAGCCTACCACGGCTCCTCCTGCTCCCGCGACTACTGCCAAC
GAGGGTGTCACTACTGGTGGTGGAACTAATGGATTTGATGCGTCTGGGAGACTAAATTGGTGGAGAGCGTATAGG
TTCCCTGCTGTTGCGTCTGCTGGTGCTACTCATGCGGGTGGTGGAGGCGCTGATGGTGTTCCTGCTGCTGCTAGG
ACGAGAAGTGGACCTTTTGCGACTGCGACTGCGACTGCGACTGGATCGTCTTCGAGAACTGGTATACCTGCCACT
TCGTCATCGGATGTCATTCCTCCATTTTCGCCATTATCGACATTTTCATCATCAATGGATCCTTCATCTCATACC
CATCATCAAGATAATACAACAAGTCCTACTAATACCACTCCCCCTCCTGCTTCACATTCGACGACATCGGCTACT
ACTACCAATGTGAATGAGACTACGGCGAACTCGAATTCGGTTGTTCCTGTGATTATTGTTGGTTTACAATCTGTT
AATGCGCCTAATTGGAGACCTTTGATGGGATTGGAGGGGGATGATTTGTGGGATCATAATCATCCTCATCCTCAC
CATCATCAACATCATCATCATAATCCTCATCTTCGATTTAATCATAATCATAATCATAGTCGGTTAGATCGACAT
CGGAGACGACGGAGTGGGTTTAGTGATTTGATTCATCGACGTGAGGAAGGTGAAGAGGAAGATATGTTTGTGATG
AGAGAGGAAGAAGAAGAAAATGAAGATGAGGATGAGGATGATGATGGTAATGAAGATGAAATTGGAAGAGAGAGA
GAGGAAGAGATGATGATGGGTATTGATGATCTTCATATAGAAGATGATGATGGTAGTTCGTTTTATGAAACTCAT
AGTCGAGGTCCTCGACGATTACGAGAACGAGAACGAGAGAGAGAAAGACGAGGGTGGAGGAATGCGTTTGGTGGA
CTTAGGTCTGGTGCGGGTAGTAGTGGGAGTGGGAGTGGGAGTGGGAGTTTTGGACGGGAAGGTCAGAGTGCGAGT
AGTAGTGGTGGTGAAGGAGGGTATAATAGGCGAGAACAATCAGCGACGATGAATGTGCCTCCTTCACCTATGGGA
GGACCTGGGTCAAGGACGTTTTTGATCTATGTCATTGGTGGTTATTACCCACCGGATCATAGTATCGTTACTGGA
GGTCCAGATAACCTAGAATCATTCGAAGCTCTTTTGGAACTTGTTGAAATGTTGGGAAGTGCTAAAGCTTCGACG
GCGTCGAAAGATGATATCGAAAAATCGGGATTGGAGGTGATCAAGAGGTCACAGTTGGAGATGTACGAACGGGAG
AAAAAGGTTTCGTCGAATTGTGTTGAAAGGTGTTTGATATGTTTGGATGAATATGAAGAGGAAGATGAGATACGC
GTGATGAATTGTCGACATGCGTTTCATAGGGGATGTGTGGATACGTGGTTGCAGACGGGGAAAAATAATTGTCCT
GCTTGTCGGTCGACTGGAGTAGCATCGACTTCGACATCGACATCATCGACGACGCAGGCGCAGGCGCAGACTGCT
GCTGTGCCTCCTCAACCTTTGGTTTGA
Transcript >Agabi119p4|097890
ATGGGCCAGTCTTCGTCCCGTCCACGCAACCCGCTCAGGCACTTTCTCGGGCGCAGGAGAGACGCTGACAAAGAC
AACACCAACGACGACGACGACGACGGCCCGCAACCTGGCCCGCTCCCGCCTCAGCCCTCCGTCCCGCCCCCGCTG
CCCCCGCCGTCGCCGCCACCGCCATCCCCACCACCGCCGCCACCACCGCCGCCACCAGCACCACCAACACCACCA
CGTCAATTTCCTCCACCCGGCACTCTCGTCGTCGTTCAGGGCATCGTCCACACCACCGACGTCTCCCGCGCCAAT
CCCAACACTGGCGATACCGTCGTCGACAGTGATATCCATCGGAACAACGGATCGTCATCAGTTCCTGCATCTCCC
TCTTCTTCAGCATCGATTGCTAGAGATCGACTTTTGTCGCTGCTCGGACGACGGGCATCCACACCTGCCACGGGT
GAAAATTTAGACACCGAAGACGATGCTCCAGCTGTACTTTCGGATGGCAGTCCTGATCACTTTCATCCGTCTCCG
CAACCGCAGTCGCCACGAGTACGACGTGGAACCGCTCATTCCGCCACTGCACGAGGGCCATCATATCAACAACGT
GGTCAGCAGCGTCAAAATGAGGACCGATCGGCTATTTCATCAAATAGTATCGACGTTCTTGGAACCTTACTCAGT
GTTGCTGCTGCTGCTACTGCCGCTTCTTTACTGACGGGATCGTCGGAACCTATCTTATCTTCCGGATTGGCGCCG
CCTCCACCTGCTACTAGTTCCACTTCGAATGCGTTCGCTCCTTCCCCGCCCCCCACTTCCGATATTTCGCCTACA
CCCGCACTACAACCGGTATCACGTCCAGTACCCCAACATACCCCATCGCCATCAGCTTTGGAGGTGCCACCTGAA
CGGCGCGATGGCGGTAACGGACAACAGGAACAAACACAACCGTTATCATCAACGTCAACGACGATGTTCAATGAT
CGGAGAGTTGTTGAAAGAAGACGGACTACTTGGAATATGTTGAGAGAGAGGCTGAGGTTACGTGCGAGAGATACT
GTGGAATCATCACCTTCGTCACAACCACCGCAATTACCACCGCCGCCACCGCCACCGCCACGACCTCAACAACAC
CTCGAGCCTACGTCGAGGACATCGCCCCACGCATCACCATTTATTCCTCCCCCACCGTCATCGTCATCTACCCCA
GAACATGAAAGGGGAGGACGTGAACGCGAACGATACAGACCTGGATTCTCATCACCTTCATTACCTCCTTCTCTA
TCAGCATCAACATCCACGAATACAACCACACCAACAACAACATCCTCATCTTCATCCTCATCACCTCCAACGGCT
ATGTCTATGCCTACGTTGACGGATACAAGAGAACAAATGTTGGCCGAGATGGCTAGAGCATTTAATCTCGGATTG
GGATTAAACGGTGGCGGAAGTGGTGGTAGTGGGAGCGTGTTTGGTGGATTCAGTCCTCACCATGGTAATAATACT
CAAGGACAAACAGGGGGCGGGGATGCTGATAATGAGGGAAGAGGGAGGGAGTTACCGCCTGAAGGATCTTTTGAA
CGGTTTTTGGTGGAGTTGCAGGCGGATTTGAGAGTGGTGTTGAGTTTGGATTCGAGGAGTGAGGAGGAGGAGGAG
AGGGGAGATCGAGCGAGGAATGAGAATGAGACTGAACAAGAAGAGGAGGTTACGACGGGGAGGAGAGCTAGGGGA
CTTTCGGTTGGGTCTTTGGTACCTACCGAACCTGCTGAGAGTGTTCATTCCGTGGAGGATCCGAATATGCCTGCT
TTACAAGATGTTACGGATGATGACTCTTCGAATGGTCAAACTGAATTGAGCGATGATGATGACGACGACTTTTTG
TCGGCTACGACATCCACACCGGTTTTGGCTCCTACTTTATCATCTGAAGAACCGAGTCGTGGTTTGGAATTACCG
AGGATTCCGAGACCTGTTTTGGAAGTTGTTGAAGATGAGGAAGAGGAAAGTGAAGCCGTAGAAGTCTCGCCTACA
ACCACAACAGCAACGACGACGACGATTCCTAATGAGCCTACCACGGCTCCTCCTGCTCCCGCGACTACTGCCAAC
GAGGGTGTCACTACTGGTGGTGGAACTAATGGATTTGATGCGTCTGGGAGACTAAATTGGTGGAGAGCGTATAGG
TTCCCTGCTGTTGCGTCTGCTGGTGCTACTCATGCGGGTGGTGGAGGCGCTGATGGTGTTCCTGCTGCTGCTAGG
ACGAGAAGTGGACCTTTTGCGACTGCGACTGCGACTGCGACTGGATCGTCTTCGAGAACTGGTATACCTGCCACT
TCGTCATCGGATGTCATTCCTCCATTTTCGCCATTATCGACATTTTCATCATCAATGGATCCTTCATCTCATACC
CATCATCAAGATAATACAACAAGTCCTACTAATACCACTCCCCCTCCTGCTTCACATTCGACGACATCGGCTACT
ACTACCAATGTGAATGAGACTACGGCGAACTCGAATTCGGTTGTTCCTGTGATTATTGTTGGTTTACAATCTGTT
AATGCGCCTAATTGGAGACCTTTGATGGGATTGGAGGGGGATGATTTGTGGGATCATAATCATCCTCATCCTCAC
CATCATCAACATCATCATCATAATCCTCATCTTCGATTTAATCATAATCATAATCATAGTCGGTTAGATCGACAT
CGGAGACGACGGAGTGGGTTTAGTGATTTGATTCATCGACGTGAGGAAGGTGAAGAGGAAGATATGTTTGTGATG
AGAGAGGAAGAAGAAGAAAATGAAGATGAGGATGAGGATGATGATGGTAATGAAGATGAAATTGGAAGAGAGAGA
GAGGAAGAGATGATGATGGGTATTGATGATCTTCATATAGAAGATGATGATGGTAGTTCGTTTTATGAAACTCAT
AGTCGAGGTCCTCGACGATTACGAGAACGAGAACGAGAGAGAGAAAGACGAGGGTGGAGGAATGCGTTTGGTGGA
CTTAGGTCTGGTGCGGGTAGTAGTGGGAGTGGGAGTGGGAGTGGGAGTTTTGGACGGGAAGGTCAGAGTGCGAGT
AGTAGTGGTGGTGAAGGAGGGTATAATAGGCGAGAACAATCAGCGACGATGAATGTGCCTCCTTCACCTATGGGA
GGACCTGGGTCAAGGACGTTTTTGATCTATGTCATTGGTGGTTATTACCCACCGGATCATAGTATCGTTACTGGA
GGTCCAGATAACCTAGAATCATTCGAAGCTCTTTTGGAACTTGTTGAAATGTTGGGAAGTGCTAAAGCTTCGACG
GCGTCGAAAGATGATATCGAAAAATCGGGATTGGAGGTGATCAAGAGGTCACAGTTGGAGATGTACGAACGGGAG
AAAAAGGTTTCGTCGAATTGTGTTGAAAGGTGTTTGATATGTTTGGATGAATATGAAGAGGAAGATGAGATACGC
GTGATGAATTGTCGACATGCGTTTCATAGGGGATGTGTGGATACGTGGTTGCAGACGGGGAAAAATAATTGTCCT
GCTTGTCGGTCGACTGGAGTAGCATCGACTTCGACATCGACATCATCGACGACGCAGGCGCAGGCGCAGACTGCT
GCTGTGCCTCCTCAACCTTTGGTTTGA
Gene >Agabi119p4|097890
ATGGGCCAGTCTTCGTCCCGTCCACGCAACCCGCTCAGGCACTTTCTCGGGCGCAGGAGAGACGCTGACAAAGAC
AACACCAACGACGACGACGACGACGGCCCGCAACCTGGCCCGCTCCCGCCTCAGCCCTCCGTCCCGCCCCCGCTG
CCCCCGCCGTCGCCGCCACCGCCATCCCCACCACCGCCGCCACCACCGCCGCCACCAGCACCACCAACACCACCA
CGTCAATTTCCTCCACCCGGCACTCTCGTCGTCGTTCAGGGCATCGTCCACACCACCGACGTCTCCCGCGCCAAT
CCCAACACTGGCGATACCGTCGTCGACAGTGATATCCATCGGAACAACGGATCGTCATCAGTTCCTGCATCTCCC
TCTTCTTCAGCATCGATTGCTAGAGATCGACTTTTGTCGCTGCTCGGACGACGGGCATCCACACCTGCCACGGGT
GAAAATTTAGACACCGAAGACGATGCTCCAGCTGTACTTTCGGATGGCAGTCCTGATCACTTTCATCCGTCTCCG
CAACCGCAGTCGCCACGAGTACGACGTGGAACCGCTCATTCCGCCACTGCACGAGGGCCATCATATCAACAACGT
GGTCAGCAGCGTCAAAATGAGGACCGATCGGCTATTTCATCAAATAGTATCGACGTTCTTGGAACCTTACTCAGG
TCCGTACAAGTGTCATGAGTCGTATTTTTTTGTTCACTTTTTGTTTTTTGTAGTGTTGCTGCTGCTGCTACTGCC
GCTTCTTTACTGACGGGATCGTCGGAACCTATCTTATCTTCCGGATTGGCGCCGCCTCCACCTGCTACTAGTTCC
ACTTCGAATGCGTTCGCTCCTTCCCCGCCCCCCACTTCCGATATTTCGCCTACACCCGCACTACAACCGGTATCA
CGTCCAGTACCCCAACATACCCCATCGCCATCAGCTTTGGAGGTGCCACCTGAACGGCGCGATGGCGGTAACGGA
CAACAGGAACAAACACAACCGTTATCATCAACGTCAACGACGATGTTCAATGATCGGAGAGTTGTTGAAAGAAGA
CGGACTACTTGGAATATGTTGAGAGAGAGGCTGAGGTTACGTGCGAGAGATACTGTGGAATCATCACCTTCGTCA
CAACCACCGCAATTACCACCGCCGCCACCGCCACCGCCACGACCTCAACAACACCTCGAGCCTACGTCGAGGACA
TCGCCCCACGCATCACCATTTATTCCTCCCCCACCGTCATCGTCATCTACCCCAGAACATGAAAGGGGAGGACGT
GAACGCGAACGATACAGACCTGGATTCTCATCACCTTCATTACCTCCTTCTCTATCAGCATCAACATCCACGAAT
ACAACCACACCAACAACAACATCCTCATCTTCATCCTCATCACCTCCAACGGCTATGTCTATGCCTACGTTGACG
GATACAAGAGAACAAATGTTGGCCGAGATGGCTAGAGCATTTAATCTCGGATTGGGATTAAACGGTGGCGGAAGT
GGTGGTAGTGGGAGCGTGTTTGGTGGATTCAGTCCTCACCATGGTAATAATACTCAAGGACAAACAGGGGGCGGG
GATGCTGATAATGAGGGAAGAGGGAGGGAGTTACCGCCTGAAGGATCTTTTGAACGGTTTTTGGTGGAGTTGCAG
GCGGATTTGAGAGTGGTGTTGAGTTTGGATTCGAGGAGTGAGGAGGAGGAGGAGAGGGGAGATCGAGCGAGGAAT
GAGAATGAGACTGAACAAGAAGAGGAGGTTACGACGGGGAGGAGAGCTAGGGGACTTTCGGTTGGGTCTTTGGTA
CCTACCGAACCTGCTGAGAGTGTTCATTCCGTGGAGGATCCGAATATGCCTGCTTTACAAGATGTTACGGATGAT
GACTCTTCGAATGGTCAAACTGAATTGAGCGATGATGATGACGACGGTACGTCTCTTTCCTTCTCTTGGTAAATT
TTATTGAAATCTTGCTTTTTAAAAAAAGACTTTTTGTCGGCTACGACATCCACACCGGTTTTGGCTCCTACTTTA
TCATCTGAAGAACCGAGTCGTGGTTTGGAATTACCGAGGATTCCGAGACCTGTTTTGGAAGTTGTTGAAGATGAG
GAAGAGGAAAGTGAAGCCGTAGAAGTCTCGCCTACAACCACAACAGCAACGACGACGACGATTCCTAATGAGCCT
ACCACGGCTCCTCCTGCTCCCGCGACTACTGCCAACGAGGGTGTCACTACTGGTGGTGGAACTAATGGATTTGAT
GCGTCTGGGAGACTAAATTGGTGGAGAGCGTATAGGTTCCCTGCTGTTGCGTCTGCTGGTGCTACTCATGCGGGT
GGTGGAGGCGCTGATGGTGTTCCTGCTGCTGCTAGGACGAGAAGTGGACCTTTTGCGACTGCGACTGCGACTGCG
ACTGGATCGTCTTCGAGAACTGGTATACCTGCCACTTCGTCATCGGATGTCATTCCTCCATTTTCGCCATTATCG
ACATTTTCATCATCAATGGATCCTTCATCTCATACCCATCATCAAGATAATACAACAAGTCCTACTAATACCACT
CCCCCTCCTGCTTCACATTCGACGACATCGGCTACTACTACCAATGTGAATGAGACTACGGCGAACTCGAATTCG
GTTGTTCCTGTGATTATTGTTGGTTTACAATCTGTTAATGCGCCTAATTGGAGACCTTTGATGGGATTGGAGGGG
GATGATTTGTGGGATCATAATCATCCTCATCCTCACCATCATCAACATCATCATCATAATCCTCATCTTCGATTT
AATCATAATCATAATCATAGTCGGTTAGATCGACATCGGAGACGACGGAGTGGGTTTAGTGATTTGATTCATCGA
CGTGAGGAAGGTGAAGAGGAAGATATGTTTGTGATGAGAGAGGAAGAAGAAGAAAATGAAGATGAGGATGAGGAT
GATGATGGTAATGAAGATGAAATTGGAAGAGAGAGAGAGGAAGAGATGATGATGGGTATTGATGATCTTCATATA
GAAGATGATGATGGTAGTTCGTTTTATGAAACTCATAGTCGAGGTCCTCGACGATTACGAGAACGAGAACGAGAG
AGAGAAAGACGAGGGTGGAGGAATGCGTTTGGTGGACTTAGGTCTGGTGCGGGTAGTAGTGGGAGTGGGAGTGGG
AGTGGGAGTTTTGGACGGGAAGGTCAGAGTGCGAGTAGTAGTGGTGGTGAAGGAGGGTATAATAGGCGAGAACAA
TCAGCGACGATGAATGTGCCTCCTTCACCTATGGGAGGACCTGGGTCAAGGACGTTTTTGATCTATGTCATTGGT
GGCAAGTTTCCCCCTCTTTGCTTTTCTCTTTTCGTTTATGAGATTGACCTCTTTTATATAGGTTATTACCCACCG
GATCATAGTATCGTTACTGGAGGTCCAGATAACCTAGAATCATTCGAAGCTCTTTTGTATGTTTTCTTTTCTTTT
CCTTCTCTCATCTGGTTGTTTCAACAACGAATTTTTTTAGGGAACTTGTTGAAATGTTGGGAAGTGCTAAAGCTT
CGACGGCGTCGAAAGATGATATCGAAAAATCGGGATTGGAGGTGATCAAGAGGTCACAGTTGGAGATGTACGAAC
GGGAGAAAAAGGTTTCGTCGAATTGTGTTGAAAGGGTACGTCTATCATCATCATCACCCTTTTTAGATAACACGA
AAACTGATGGGATGATAAAAAATGAATAGTGTTTGATATGTTTGGATGAATATGAAGAGGAAGATGAGATACGCG
TGATGAATTGTCGACATGCGTTTCATAGGGGATGTGTGGATACGTGGTTGCAGACGGGGAAAAATAATTGTCCTG
CTTGTCGGTCGACTGGAGTAGCATCGACTTCGACATCGACATCATCGACGACGCAGGCGCAGGCGCAGACTGCTG
CTGTGCCTCCTCAACCTTTGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail