Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|097510
Gene name
Locationscaffold_07:95438..99068
Strand-
Gene length (bp)3630
Transcript length (bp)2163
Coding sequence length (bp)2163
Protein length (aa) 721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15 1.7E-49 331 672
PF19291 TREH_N Trehalase-like, N-terminal 3.4E-16 7 149

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10211|YAY3_SCHPO Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.03c PE=4 SV=1 5 696 0.0E+00
sp|A0R0W9|TREH_MYCS2 Trehalase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_4535 PE=1 SV=1 302 712 4.0E-81
sp|P71741|TREH_MYCTU Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2402 PE=1 SV=2 310 712 1.0E-79
sp|A0R0W9|TREH_MYCS2 Trehalase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_4535 PE=1 SV=1 5 139 2.0E-15
sp|P71741|TREH_MYCTU Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2402 PE=1 SV=2 5 241 2.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|097510
MERGYLPIADHALIGNLRTAALVSLDGSVESYCVPHFDSPSVFARILDKDKGGHFSIQPTISCRSKQNYLPSSNV
LQTKFMNEVGVVSVTDFLPRPLHPSPFGASHPKPLLPWLIRRVECIRGALTVNVEVAPAFNYARNPHTTSIVDDD
TAEKHQKAVEKRQKAVFESADLTLDLRYVTEKTVAEAIEPPIVVLTTLDLSAKGHKGLAVQATISLVEGQAVTFV
LRHPPGSTNSYASPQIQAPKPQTTLGPEVPQAGISQAPRATVGTVDAQSRKASVGVTALENDGSVPHARPHDDPY
LTKELVHSLLHMTNRYWYDWIRQSTYTGSWKEAVLRSALALKLLIFEPTGAVVASPTFSLPEYIGGTRNWDYRYS
WIRDSSFTLYALIRLGFTEEANAFLGFIFERLRDKNPDGSLQIMYTIHGEKEIPEIELTHLDGHKSSKPVRVGNG
AADHVQLDIYGELMDCVYLGQKYGKPLGYDDWVLVRGVVDYVVEHIHDTDLSIWEVRNRQRHFTYSKIMLWVAID
RGLRLADKRSLPCPNRLKWLAARDELYEEIMELAWNKEGKYFGQSYEETDVLDSAVLIMPLVFFMQASDPRFVST
LKQILKTPDKGGLTSNNLVYRYDTRKSDDGVGGEEGTFCLCTLWCIEALTRAGQSDKTFLPKAVSMFEDFLLYLN
HVGLCSEEVSDAGEGLGNAVQGFTHVTLISAAYNLSRTLDKGSVE*
Coding >Agabi119p4|097510
ATGGAACGTGGGTACCTGCCCATCGCCGACCACGCACTTATCGGCAACCTCAGAACAGCTGCCTTAGTCAGTCTA
GATGGCTCTGTTGAGAGTTACTGCGTGCCCCACTTCGATTCACCATCCGTCTTCGCTCGCATCCTAGACAAAGAC
AAGGGCGGCCACTTTTCTATTCAACCTACAATATCTTGTAGGTCAAAACAGAATTATTTGCCGAGCTCCAATGTT
CTCCAGACCAAGTTTATGAATGAGGTTGGTGTCGTCAGCGTCACAGATTTTCTCCCACGTCCTCTTCATCCTAGT
CCATTCGGAGCATCTCATCCGAAACCGTTACTTCCCTGGCTCATTCGTCGCGTTGAATGTATCCGAGGAGCGCTT
ACCGTTAATGTGGAAGTAGCTCCCGCATTCAATTACGCCCGCAATCCTCACACCACTAGCATCGTTGACGACGAC
ACTGCTGAAAAGCACCAGAAAGCGGTGGAAAAGCGCCAGAAAGCGGTGTTTGAATCTGCTGACCTTACCCTCGAT
TTGCGCTATGTCACCGAGAAAACTGTCGCCGAAGCGATAGAGCCTCCCATCGTTGTCTTGACGACTCTTGATCTC
TCGGCAAAAGGTCATAAAGGCCTGGCAGTTCAGGCAACGATCTCCCTTGTCGAAGGTCAAGCTGTCACTTTTGTT
CTACGACACCCCCCTGGTTCGACGAACAGTTACGCTTCGCCCCAAATCCAAGCTCCAAAGCCTCAGACGACGTTG
GGTCCCGAGGTTCCTCAGGCTGGTATTTCTCAAGCACCTCGCGCGACTGTAGGTACCGTAGATGCCCAATCGAGA
AAAGCGAGCGTAGGCGTAACTGCCTTGGAAAACGATGGATCAGTCCCTCATGCTAGGCCACATGACGATCCTTAC
CTCACCAAAGAACTTGTTCACTCTCTCCTCCATATGACAAATAGGTATTGGTATGATTGGATACGCCAAAGCACA
TACACTGGTTCTTGGAAAGAAGCCGTTTTACGTAGTGCCCTTGCCCTCAAACTTCTCATCTTTGAGCCCACAGGT
GCCGTTGTCGCCAGTCCTACGTTCAGCTTACCCGAATATATCGGTGGCACAAGGAATTGGGATTACAGATATTCA
TGGATCCGAGACTCTTCCTTCACGCTCTATGCTCTTATTCGGTTGGGTTTCACTGAAGAAGCCAATGCTTTCCTC
GGGTTCATTTTTGAACGTTTGAGGGATAAAAATCCTGATGGAAGTCTTCAGATCATGTATACCATTCACGGTGAA
AAGGAAATACCAGAGATAGAATTGACGCATCTAGATGGACATAAGAGCTCTAAACCTGTTCGTGTTGGAAATGGT
GCTGCAGATCATGTTCAGCTGGATATTTATGGCGAGCTGATGGATTGTGTTTACCTTGGTCAGAAATATGGTAAA
CCTCTTGGCTATGACGATTGGGTCTTGGTTCGGGGAGTGGTTGACTATGTCGTCGAACACATCCATGATACAGAT
TTGTCTATTTGGGAAGTGAGGAATCGTCAGAGGCATTTTACTTACTCCAAGATCATGCTTTGGGTAGCCATTGAT
CGAGGTCTGCGTCTTGCAGACAAACGATCTTTGCCTTGCCCAAATAGACTCAAATGGCTCGCTGCTCGCGACGAG
CTTTACGAAGAGATTATGGAACTTGCATGGAATAAGGAAGGCAAATATTTTGGACAGAGTTATGAAGAGACGGAT
GTGCTTGATTCTGCGGTTTTGATTATGCCATTGGTGTTCTTTATGCAAGCTTCCGACCCGAGATTTGTTTCGACT
TTGAAACAGATTTTGAAAACGCCGGACAAAGGGGGTTTGACTTCAAACAATCTTGTGTATCGATATGATACCAGA
AAATCAGATGATGGTGTTGGAGGAGAAGAAGGAACATTCTGTTTGTGCACACTTTGGTGTATTGAAGCACTTACC
CGGGCCGGTCAAAGCGATAAAACTTTTTTGCCTAAAGCGGTTTCAATGTTCGAGGACTTCTTGTTATATTTGAAT
CATGTGGGGTTATGTTCTGAAGAGGTTTCGGATGCTGGCGAAGGGCTGGGTAATGCCGTTCAAGGGTTCACGCAT
GTTACTCTGATTTCGGCCGCTTACAATCTCTCGAGGACGTTGGACAAGGGATCAGTTGAGTAG
Transcript >Agabi119p4|097510
ATGGAACGTGGGTACCTGCCCATCGCCGACCACGCACTTATCGGCAACCTCAGAACAGCTGCCTTAGTCAGTCTA
GATGGCTCTGTTGAGAGTTACTGCGTGCCCCACTTCGATTCACCATCCGTCTTCGCTCGCATCCTAGACAAAGAC
AAGGGCGGCCACTTTTCTATTCAACCTACAATATCTTGTAGGTCAAAACAGAATTATTTGCCGAGCTCCAATGTT
CTCCAGACCAAGTTTATGAATGAGGTTGGTGTCGTCAGCGTCACAGATTTTCTCCCACGTCCTCTTCATCCTAGT
CCATTCGGAGCATCTCATCCGAAACCGTTACTTCCCTGGCTCATTCGTCGCGTTGAATGTATCCGAGGAGCGCTT
ACCGTTAATGTGGAAGTAGCTCCCGCATTCAATTACGCCCGCAATCCTCACACCACTAGCATCGTTGACGACGAC
ACTGCTGAAAAGCACCAGAAAGCGGTGGAAAAGCGCCAGAAAGCGGTGTTTGAATCTGCTGACCTTACCCTCGAT
TTGCGCTATGTCACCGAGAAAACTGTCGCCGAAGCGATAGAGCCTCCCATCGTTGTCTTGACGACTCTTGATCTC
TCGGCAAAAGGTCATAAAGGCCTGGCAGTTCAGGCAACGATCTCCCTTGTCGAAGGTCAAGCTGTCACTTTTGTT
CTACGACACCCCCCTGGTTCGACGAACAGTTACGCTTCGCCCCAAATCCAAGCTCCAAAGCCTCAGACGACGTTG
GGTCCCGAGGTTCCTCAGGCTGGTATTTCTCAAGCACCTCGCGCGACTGTAGGTACCGTAGATGCCCAATCGAGA
AAAGCGAGCGTAGGCGTAACTGCCTTGGAAAACGATGGATCAGTCCCTCATGCTAGGCCACATGACGATCCTTAC
CTCACCAAAGAACTTGTTCACTCTCTCCTCCATATGACAAATAGGTATTGGTATGATTGGATACGCCAAAGCACA
TACACTGGTTCTTGGAAAGAAGCCGTTTTACGTAGTGCCCTTGCCCTCAAACTTCTCATCTTTGAGCCCACAGGT
GCCGTTGTCGCCAGTCCTACGTTCAGCTTACCCGAATATATCGGTGGCACAAGGAATTGGGATTACAGATATTCA
TGGATCCGAGACTCTTCCTTCACGCTCTATGCTCTTATTCGGTTGGGTTTCACTGAAGAAGCCAATGCTTTCCTC
GGGTTCATTTTTGAACGTTTGAGGGATAAAAATCCTGATGGAAGTCTTCAGATCATGTATACCATTCACGGTGAA
AAGGAAATACCAGAGATAGAATTGACGCATCTAGATGGACATAAGAGCTCTAAACCTGTTCGTGTTGGAAATGGT
GCTGCAGATCATGTTCAGCTGGATATTTATGGCGAGCTGATGGATTGTGTTTACCTTGGTCAGAAATATGGTAAA
CCTCTTGGCTATGACGATTGGGTCTTGGTTCGGGGAGTGGTTGACTATGTCGTCGAACACATCCATGATACAGAT
TTGTCTATTTGGGAAGTGAGGAATCGTCAGAGGCATTTTACTTACTCCAAGATCATGCTTTGGGTAGCCATTGAT
CGAGGTCTGCGTCTTGCAGACAAACGATCTTTGCCTTGCCCAAATAGACTCAAATGGCTCGCTGCTCGCGACGAG
CTTTACGAAGAGATTATGGAACTTGCATGGAATAAGGAAGGCAAATATTTTGGACAGAGTTATGAAGAGACGGAT
GTGCTTGATTCTGCGGTTTTGATTATGCCATTGGTGTTCTTTATGCAAGCTTCCGACCCGAGATTTGTTTCGACT
TTGAAACAGATTTTGAAAACGCCGGACAAAGGGGGTTTGACTTCAAACAATCTTGTGTATCGATATGATACCAGA
AAATCAGATGATGGTGTTGGAGGAGAAGAAGGAACATTCTGTTTGTGCACACTTTGGTGTATTGAAGCACTTACC
CGGGCCGGTCAAAGCGATAAAACTTTTTTGCCTAAAGCGGTTTCAATGTTCGAGGACTTCTTGTTATATTTGAAT
CATGTGGGGTTATGTTCTGAAGAGGTTTCGGATGCTGGCGAAGGGCTGGGTAATGCCGTTCAAGGGTTCACGCAT
GTTACTCTGATTTCGGCCGCTTACAATCTCTCGAGGACGTTGGACAAGGGATCAGTTGAGTAG
Gene >Agabi119p4|097510
ATGGAACGTGGGTACCTGCCCATCGCCGACCACGCACTGTGAGTATCTAAACCCATGACGTCGACTCCAAAAAAA
CAACTCTTGTTCCACCAGTATCGGCAACCTCAGAACAGCTGCCTTAGTCAGTCTAGATGGCTCTGGTCCGTATAT
CCAATTCGACTTCCTCCGTTGCCGTGCTGACTGACTTGTGTACAGTTGAGAGTTACTGCGTGCCCCACTTCGATT
CACCATCCGTCTTCGCTCGCATCCTAGACAAAGACAAGGGCGGCCACTTTTCTATTCAACCTACAATATCTTGTA
GGTCAAAACAGAATTATTTGCCGAGCTCCAATGTTCTCCAGACCAAGTTTATGAATGAGGTTGGTGTCGTCAGCG
TCACAGGTATGTCGTTTTGTTTCTCTTTCACCAACCTTCATTCTGACGCATCAACAGATTTTCTCCCACGTCCTC
TTCATCCTAGTCCATTCGGAGCATCTCATCCGAAACCGTTACTTCCCTGGCTCATTCGTCGCGTTGAATGTATCC
GAGGAGCGCTTACCGTTAATGTGGAAGTAGCTCCCGCATTCAATTACGCCCGCAATCCTCACACCACTAGCATCG
TTGACGACGACACTGCTGAAAAGCACCAGAAAGCGGTGGAAAAGCGCCAGAAAGCGGTGTTTGAATCTGCTGACC
TTACCCTCGATTTGCGCTATGTCACCGAGAAAACTGTCGCCGAAGCGATAGAGCCTCCCATCGTTGTCTTGACGA
CTCTTGATCTCTCGGCAAAAGGTCATAAAGGCCTGGCAGTTCAGGCAACGATCTCCCTTGTCGAAGGTCAAGCTG
TCACTTTTGTTCTACGACACCCCCCTGGTTCGACGAACAGTTACGCTTCGCCCCAAATCCAAGCTCCAAAGCCTC
AGACGACGTTGGGTCCCGAGGTTCCTCAGGCTGGTATTTCTCAAGCACCTCGCGCGACTGTAGGTACCGTAGATG
CCCAATCGAGAAAAGCGAGCGTAGGCGTAACTGCCTTGGAAAACGATGGATCAGTCCCTCATGCTAGGCCACATG
ACGATCCTTACCTCACCAAAGTAAGCCTGGAATGGTCAAATCATTTCGAAGCCTACTCAATCTCCACCTTTAGGA
ACTTGTTCACTCTCTCCTCCATGTAAGTCTTGGTACTAAGAAATTTTCTCCCAGCACATCGATTTTCTGTTATAG
ATGACAAATAGGTATTGGTATGATTGGATACGCCAAAGCACATACACTGGTTCTTGGAAAGAAGCCGTTTTACGT
AGTGCCCTTGCCCTCAAACTTCTCATCTTTGAGCCCACAGGTTCGTCTTGTACTAACCTGTGTTCTCTTTGTAAC
TCGAAAAGCTGACGTATTGGGGCTCTCAGGTGCCGTTGTCGCCAGTCCTACGTTCAGCTTACCCGAATATATCGG
TGGCACAAGGAATTGGTAGGTCTACCGAAAATGAAACTTTATATGTAGTTCGTCGATTCAGAATTCGTTTTTAAG
GGATTACAGATATTCATGGATCCGAGACTCTTCCTTCACGCTCTATGCTCTTATTCGGTTGGGTTTCACTGAAGA
AGCCAATGGTCAGAATCACTGTCACGCGCCGAAGCTTAGATGGCTTACACCCTTTTCGCAGCTTTCCTCGGGTTC
ATTTTTGAACGTTTGAGGGATAAAAATCCTGATGGAAGTCTTCAGATCATGTATACCATTCACGGTAAGTCAGTT
TTTATATTTCCTCCCCATGGAACCCATATGTCTCGCTAGGTGAAAAGGAAATACCAGAGATAGAATTGACGCATC
TAGATGGACATAAGAGCTCTAAACCTGTTCGTGTTGGAAATGGTGCTGCAGATCATGTTCAGCTGGCAAGTGATT
CTGTTTGCGTGCGTAAATGATTTTTGACCGGTGTATGGAATAGGATATTTATGGCGAGCTGTAAGATTTAGTTGG
CTCTATCAAGTGCAGGAAAGAAATATTCATCTTTTCTTGGATAGGATGGATTGTGTTTACCTTGGTCAGAAAGTG
AGTCATGATCTCCGGTATGATTATATGGAATATGACGTTCTTTTTTTAGTATGGTAAACCTCTTGTACGTGTTTT
TTCATGGGGATAAAGTTGTGAATGTTCTGATATATCATTGCGTTCGTGGTAGGGCTATGACGATTGGTGCGTAAA
CAGTGAAAAACCGGTCTCCTTTGAATCGGAATGCTCATTAGTCTTTCAGGGTCTTGGTTCGGGGAGTGTAGGTGC
TATTCTGCTTCGTGCCATTTCTCCTTCTGAGCATCAACTTCAATATAGGGTTGACTGTAAGCGCTTCTCGGTACC
TATTGCTGGGCGGTGATGGTGACTGATCACATGTTCGTATTAGATGTCGTCGAACACATCCATGATACAGATTTG
TGAGCTCTTGTATATCTTATCCACAAGTCGTAGCCTAACTTTTGTTTGCTTCAAAGGTCTATTTGGTCTGTTCAG
TTCTTCCTCGCCTAGAATTGAGGGAAGTTAAATTACTTATAGGGAAGTGAGGAATCGTCAGAGGCATTTTACTGT
GAGTTGTTGCCGCCCTCAGTCTGGTATATCAAGATCCTGACATGAGTTGTATAGTACTCCAAGGTATAGTAATTT
TCGTCCAATATTACCCAAAATAATGAGTATTTGTAGATCATGCTTTGGGTAGCCATTGATCGAGGTAAGTTTGAT
ACTCCTCTTTCTCCCTTCGTGAAGAAGAAGAATAAAGACTTGTTATCATGTAGGTCTGCGTCTTGCAGACAAACG
ATCTTTGCCTTGCCCAAATAGACTCAAATGGCTCGCTGCTCGCGACGAGCTTTACGAAGAGATTATGGAACTTGC
ATGGAATAAGGAAGGCAAATATTTTGGACAGAGTTATGAAGAGACGGATGTGCTTGATTCTGCGGTTTTGATTAT
GCCATTGGTGTTCTTTATGCAAGCTGTGAGTTGTGAAATTGGTCTTTTCTCCCTGGATTTCGAAATTAAAATTTG
ATTAGTCCGACCCGAGATTTGTTTCGACTTTGAAACAGATTTTGAAAACGCCGGACAAAGGGGGTTTGACTTCAA
ACGTACGAAATTATATTCATCTCTTCTTTCTCAAATAATTTTCTCATTTCTATGGATAACATTCTATAGAATCTT
GTGTATCGATATGATACCAGAAAATCAGATGATGGTGTTGGAGGAGAAGAAGGAACATTCTGTTTGTGCACACTT
TGGTGTATTGAAGCACTTACCCGGGCCGGTCAAAGCGATAAAACTTTTTTGCCTAAAGCGGTTTCAATGTTCGAG
GTCAGTATTCGTTGCCAAATGCTGGTCGTTTTCTGATTCTTGATGGTGTGTTGTTTAGGACTTCTTGTTATATTT
GAATCATGTGGGGTTATGTTCTGAAGAGGTTTCGGATGCTGGCGAAGGGTGTGTCCCTGTTTTTTTTTTTGCGTT
TTGAAGTGAGCTGATGAGCTGAGTTTGTTTAAGGCTGGGTAATGCCGTTCAAGGGTTCACGTATGTTTCTTCTGT
CACTTCGCTCCTCGGTATAAGCTGATATCCTGATCTAGGCATGTTACTCTGATTTCGGCCGCTTACAATCTCTCG
AGGACGTTGGACAAGGGATCAGTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail