Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|097130
Gene name
Locationscaffold_06:2398392..2398995
Strand-
Gene length (bp)603
Transcript length (bp)447
Coding sequence length (bp)447
Protein length (aa) 149

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 2.3E-21 25 145
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 4.1E-06 24 90
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 7.4E-06 54 132

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 28 145 1.0E-10
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 28 145 2.0E-10
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 29 145 4.0E-10
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 26 103 6.0E-07
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 26 103 7.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|097130
MKLSYSSVLAFASIVAGQVMLHPNTAFNKCLEVRGDVRANGTAVQIFDCNRTPAQMWQLSLGPTSVRLANSDFCL
DAGRTPLLGTPMKIWQCLENLPAQEWFLTSDDRIALVDRGLCLDLTNGNLTNTNVVQTFTCTDGNLNQVWLSG*
Coding >Agabi119p4|097130
ATGAAGCTCTCGTACTCTTCCGTTCTTGCTTTTGCCTCTATAGTCGCTGGGCAGGTGATGTTGCACCCAAACACT
GCTTTCAACAAGTGTCTCGAGGTGCGTGGTGACGTCCGGGCTAACGGCACTGCCGTCCAAATCTTCGACTGTAAT
AGAACTCCTGCTCAAATGTGGCAGCTGAGTTTGGGACCAACCTCTGTTCGTCTAGCAAACTCAGACTTCTGCCTC
GATGCTGGCCGAACTCCTCTCCTGGGTACCCCAATGAAAATCTGGCAATGTTTAGAAAACCTTCCAGCTCAAGAA
TGGTTCCTGACCTCGGATGATCGTATCGCTTTGGTCGACCGAGGTCTCTGCCTTGACTTGACCAACGGAAATCTC
ACAAACACGAATGTTGTTCAGACGTTTACGTGCACAGATGGAAATTTGAACCAAGTCTGGCTCTCTGGCTGA
Transcript >Agabi119p4|097130
ATGAAGCTCTCGTACTCTTCCGTTCTTGCTTTTGCCTCTATAGTCGCTGGGCAGGTGATGTTGCACCCAAACACT
GCTTTCAACAAGTGTCTCGAGGTGCGTGGTGACGTCCGGGCTAACGGCACTGCCGTCCAAATCTTCGACTGTAAT
AGAACTCCTGCTCAAATGTGGCAGCTGAGTTTGGGACCAACCTCTGTTCGTCTAGCAAACTCAGACTTCTGCCTC
GATGCTGGCCGAACTCCTCTCCTGGGTACCCCAATGAAAATCTGGCAATGTTTAGAAAACCTTCCAGCTCAAGAA
TGGTTCCTGACCTCGGATGATCGTATCGCTTTGGTCGACCGAGGTCTCTGCCTTGACTTGACCAACGGAAATCTC
ACAAACACGAATGTTGTTCAGACGTTTACGTGCACAGATGGAAATTTGAACCAAGTCTGGCTCTCTGGCTGA
Gene >Agabi119p4|097130
ATGAAGCTCTCGTACTCTTCCGTTCTTGCTTTTGCCTCTATAGTCGCTGGGCAGGTGATGTTGCACCCAAACACT
GCTTTCAACAAGTGTCTCGAGGTGCGTGGTGACGTCCGGGCTAACGGCACTGCCGTCCAAATGTCAGTAATTTAA
ATTTTCAACAATGTGTCGTTAAAGATTGCATCAGCTTCGACTGTAATAGAACTCCTGCTCAAATGTGGCAGCTGA
GTTTGGGACCAACCTCTGTTCGTCTAGCAAACTCAGACTTCTGCCTCGATGCTGGCCGAAGTATGCCCCTATCTA
TATATTGTGATTGTTATATTGATGAGTTTGGGCCCAGCTCCTCTCCTGGGTACCCCAATGAAAATCTGGCAATGT
TTAGAAAACCTTCCAGCTCAAGAATGGTTCCTGACCTCGGATGATCGTATCGCTTTGGTCGACCGAGGTATGTTT
TGATTAGGAATGACCCGTCATTGCTGTTATATGTTAATTTACTGTTTAGGTCTCTGCCTTGACTTGACCAACGGA
AATCTCACAAACACGAATGTTGTTCAGACGTTTACGTGCACAGATGGAAATTTGAACCAAGTCTGGCTCTCTGGC
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail