Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|096770
Gene name
Locationscaffold_06:2260060..2262737
Strand+
Gene length (bp)2677
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 9.3E-14 66 99
PF00320 GATA GATA zinc finger 6.3E-16 242 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 66 362 2.0E-53
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 8 291 8.0E-49
sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fep1 PE=1 SV=1 60 312 2.0E-42
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 47 292 1.0E-34
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 242 292 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 66 362 2.0E-53
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 8 291 8.0E-49
sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fep1 PE=1 SV=1 60 312 2.0E-42
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 47 292 1.0E-34
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 242 292 3.0E-16
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 240 293 8.0E-16
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 224 291 1.0E-15
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 238 293 2.0E-15
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 240 304 3.0E-15
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 240 304 3.0E-15
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 234 292 2.0E-14
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 240 305 4.0E-14
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 240 293 6.0E-14
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 240 293 8.0E-14
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 242 291 9.0E-14
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 242 347 1.0E-13
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 240 293 1.0E-13
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 241 291 1.0E-13
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 241 304 1.0E-13
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 240 293 1.0E-13
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 241 304 1.0E-13
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 240 293 1.0E-13
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 241 291 1.0E-13
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 241 304 2.0E-13
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 241 291 2.0E-13
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 240 293 2.0E-13
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 241 291 2.0E-13
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 240 293 2.0E-13
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 241 291 2.0E-13
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 241 291 2.0E-13
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 240 293 3.0E-13
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 240 293 3.0E-13
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 241 291 3.0E-13
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 240 293 3.0E-13
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 240 293 3.0E-13
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 241 291 3.0E-13
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 241 291 3.0E-13
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 240 293 4.0E-13
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 240 293 4.0E-13
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 241 291 4.0E-13
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 241 291 4.0E-13
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 240 289 5.0E-13
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 231 293 1.0E-12
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 242 291 3.0E-12
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 242 291 5.0E-12
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 242 291 5.0E-12
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 242 291 5.0E-12
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 242 291 5.0E-12
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 242 291 5.0E-12
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 242 291 6.0E-12
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 242 291 6.0E-12
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 242 291 6.0E-12
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 242 295 6.0E-12
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 242 289 7.0E-12
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 15 108 1.0E-11
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 241 291 1.0E-11
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 242 295 2.0E-11
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 242 287 2.0E-11
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 240 291 4.0E-11
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 179 295 7.0E-11
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 242 295 1.0E-10
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 242 295 1.0E-10
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 242 295 1.0E-10
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 242 295 2.0E-10
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 217 295 2.0E-10
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 217 295 2.0E-10
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 217 295 2.0E-10
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 242 295 2.0E-10
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 242 295 2.0E-10
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 242 295 2.0E-10
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 242 295 2.0E-10
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 225 295 2.0E-10
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 242 292 2.0E-10
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 236 286 2.0E-10
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 242 295 3.0E-10
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 242 295 3.0E-10
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 197 292 3.0E-10
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 242 297 4.0E-10
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 242 295 4.0E-10
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 197 292 4.0E-10
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 242 295 5.0E-10
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 242 295 5.0E-10
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 242 295 5.0E-10
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 242 295 5.0E-10
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 242 292 6.0E-10
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 242 292 6.0E-10
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 66 107 6.0E-10
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 66 107 6.0E-10
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 66 107 6.0E-10
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 66 107 6.0E-10
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 66 107 6.0E-10
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 66 107 7.0E-10
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 233 277 8.0E-10
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 66 107 9.0E-10
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 66 107 9.0E-10
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 242 292 1.0E-09
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 28 103 1.0E-09
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 242 295 1.0E-09
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 66 103 1.0E-09
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 66 103 1.0E-09
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 66 107 1.0E-09
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 66 107 1.0E-09
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 242 289 1.0E-09
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 66 103 1.0E-09
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 242 292 1.0E-09
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 242 291 1.0E-09
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 242 292 1.0E-09
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 66 103 1.0E-09
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 66 103 1.0E-09
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 242 292 1.0E-09
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 252 299 1.0E-09
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 242 292 1.0E-09
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 242 292 1.0E-09
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 202 314 1.0E-09
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 66 105 2.0E-09
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 66 103 2.0E-09
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 66 107 2.0E-09
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 66 103 2.0E-09
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 66 103 2.0E-09
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 66 107 2.0E-09
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 66 107 2.0E-09
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 66 103 2.0E-09
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 66 107 2.0E-09
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 66 103 2.0E-09
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 242 290 2.0E-09
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 66 103 3.0E-09
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 66 103 3.0E-09
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 66 103 3.0E-09
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 66 103 3.0E-09
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 66 103 3.0E-09
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 66 103 3.0E-09
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 66 103 3.0E-09
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 66 103 3.0E-09
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 66 103 4.0E-09
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 66 103 4.0E-09
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 66 103 4.0E-09
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 66 103 4.0E-09
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 66 103 4.0E-09
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 66 103 4.0E-09
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 66 103 4.0E-09
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 66 129 5.0E-09
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 66 103 5.0E-09
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 66 103 5.0E-09
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 66 103 5.0E-09
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 66 103 6.0E-09
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 66 103 6.0E-09
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 252 293 8.0E-09
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 66 103 1.0E-08
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 66 130 1.0E-08
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 66 107 1.0E-08
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 66 105 1.0E-08
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 66 103 1.0E-08
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 252 293 1.0E-08
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 238 291 1.0E-08
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 66 105 1.0E-08
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 66 105 1.0E-08
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 66 107 2.0E-08
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 66 159 2.0E-08
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 52 105 2.0E-08
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 66 105 2.0E-08
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 66 130 2.0E-08
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 66 115 2.0E-08
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 238 291 2.0E-08
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 8 103 3.0E-08
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 66 107 3.0E-08
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 66 145 3.0E-08
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 66 120 3.0E-08
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 66 107 3.0E-08
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 66 107 3.0E-08
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 66 105 3.0E-08
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 66 105 4.0E-08
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 66 103 4.0E-08
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 66 107 4.0E-08
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 242 295 5.0E-08
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 51 105 5.0E-08
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 66 107 5.0E-08
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 66 144 6.0E-08
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 62 105 6.0E-08
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 62 105 6.0E-08
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 66 103 6.0E-08
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 66 103 6.0E-08
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 51 105 6.0E-08
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 252 291 6.0E-08
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 51 105 7.0E-08
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 66 105 7.0E-08
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 66 103 7.0E-08
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 66 105 8.0E-08
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 56 104 8.0E-08
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 66 105 1.0E-07
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 66 107 1.0E-07
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 66 105 1.0E-07
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 66 107 1.0E-07
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 66 107 2.0E-07
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 66 107 2.0E-07
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 66 107 2.0E-07
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 242 278 2.0E-07
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 66 105 2.0E-07
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 252 291 2.0E-07
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 252 291 2.0E-07
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 66 107 3.0E-07
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 66 107 3.0E-07
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 39 105 4.0E-07
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 66 103 4.0E-07
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 66 105 1.0E-06
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 242 280 1.0E-06
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 66 113 2.0E-06
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 76 105 4.0E-06
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 76 105 6.0E-06
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 76 105 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0031323 regulation of cellular metabolic process No
GO:0003676 nucleic acid binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003677 DNA binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0080090 regulation of primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|096770
MSPVVLETPVINMPNASIGSMARIQQFPSAQSEQPSNPPSETRQANSEEANGTSNANVLAPGRSPCMNCGTTATP
LWRRDADGNPVCNACGLYQKTRHTNRPVNLGRTPPPANPPTSPSLNATGVPPGPAATSTSTSPNAKGAKPVSPSN
SNPSKMSGTCPGDGRCDGTGGTSACSGCPTYNNALAAGRVGVEAPAGTAEPPADTSAKAAPEAASPVVNEPDTST
TTSTAKRPRAAVSALCCANCGTSTTPLWRRDDVGNNICNACGLYFKLHGTHRPNSMKKTVIKRRKRVPAAAAEAL
VAVGRYAGGNGGNGEESDAEAQEPKRKRTRRTRASRAAEREDEDIPMEGDEEHVSASNRKRNGWDGRSVSPQNRA
PSRSDYISRGPNAPGPFAPTGSPHSGFEIPSLAVLGNSAAAAALLNAQSSYMRSGSNAPSRTHSPLGHGATGYPL
PPGAPFYPPDMGMINFSLAVGNLMSMGVPTLPELERHYIELGEQKRRMEELLERTDRVMAGLKRGIDEMRGGSAQ
QQAPPPMAPPAQPSAPQDAPAREPEAAREERASQPEAQSAPQPEAVAASSGPERARASVWPIVEETSRD*
Coding >Agabi119p4|096770
ATGTCTCCCGTCGTACTCGAGACCCCCGTCATCAACATGCCTAATGCCTCCATTGGCTCCATGGCACGTATACAG
CAGTTTCCCAGTGCACAGTCAGAACAGCCCTCGAATCCCCCTTCAGAGACGCGTCAAGCCAACTCGGAAGAAGCG
AACGGAACTTCAAATGCTAATGTGCTGGCCCCCGGTCGCTCGCCCTGCATGAACTGTGGCACGACTGCTACCCCT
CTATGGAGGCGTGATGCAGATGGAAATCCCGTTTGCAATGCCTGTGGTCTCTACCAGAAAACACGGCATACCAAC
CGACCCGTGAATCTTGGTCGCACTCCGCCACCAGCGAACCCTCCCACATCTCCGTCTTTGAACGCCACAGGAGTA
CCGCCCGGCCCTGCAGCTACCAGCACATCTACATCCCCTAATGCAAAAGGCGCCAAGCCCGTGTCGCCATCAAAC
TCGAATCCGTCCAAGATGAGTGGCACCTGCCCTGGTGACGGTCGTTGCGACGGAACTGGTGGCACATCTGCATGC
TCGGGTTGTCCGACCTACAACAACGCTCTTGCTGCTGGCAGAGTGGGTGTCGAGGCACCGGCTGGCACAGCTGAA
CCTCCTGCTGACACATCTGCCAAGGCTGCTCCTGAGGCTGCTTCCCCTGTGGTGAACGAACCTGATACCAGTACA
ACCACCAGTACAGCAAAGCGCCCTCGGGCTGCCGTAAGCGCGTTGTGTTGTGCCAACTGTGGTACAAGTACGACT
CCCTTATGGCGAAGGGATGATGTGGGCAACAATATCTGCAATGCTTGTGGTCTATACTTCAAGCTGCACGGCACC
CATCGTCCTAACTCAATGAAGAAGACTGTAATAAAGCGGCGAAAGCGCGTTCCCGCTGCTGCAGCTGAAGCCCTC
GTAGCCGTTGGCCGCTATGCTGGTGGAAATGGAGGCAACGGAGAAGAAAGCGACGCTGAGGCACAAGAACCAAAG
AGGAAGCGTACACGCCGCACCCGGGCGTCCCGTGCCGCAGAAAGGGAAGATGAAGATATACCCATGGAAGGCGAT
GAGGAGCATGTCAGTGCTTCGAATCGGAAGAGAAACGGTTGGGATGGTCGATCTGTATCCCCTCAAAATCGTGCA
CCCTCGAGAAGTGATTATATAAGCCGTGGCCCAAACGCACCGGGTCCGTTCGCTCCAACAGGTTCTCCCCACAGT
GGATTCGAAATCCCTTCTCTTGCAGTTCTCGGTAATTCTGCAGCTGCCGCCGCGCTTCTGAATGCGCAATCGAGT
TACATGCGCTCGGGGTCGAATGCACCCAGCCGCACCCATTCACCGCTTGGCCACGGCGCCACGGGTTATCCTCTT
CCACCTGGTGCTCCGTTCTATCCCCCTGATATGGGAATGATTAACTTCAGTTTGGCAGTCGGCAATCTTATGAGT
ATGGGCGTGCCAACACTTCCCGAGCTTGAGCGCCACTATATAGAACTTGGCGAACAAAAACGACGGATGGAGGAG
TTGTTAGAACGGACTGATCGTGTTATGGCTGGTTTGAAAAGAGGAATTGACGAGATGCGCGGTGGAAGCGCTCAG
CAACAAGCACCACCACCCATGGCACCCCCTGCGCAACCTTCCGCCCCTCAAGATGCTCCCGCCCGGGAACCTGAA
GCGGCTCGTGAAGAGCGTGCCTCTCAGCCCGAAGCTCAATCTGCTCCCCAACCGGAGGCTGTTGCAGCTTCTAGT
GGGCCGGAACGCGCTCGCGCGAGCGTGTGGCCTATCGTCGAAGAAACCTCTCGTGATTAA
Transcript >Agabi119p4|096770
ATGTCTCCCGTCGTACTCGAGACCCCCGTCATCAACATGCCTAATGCCTCCATTGGCTCCATGGCACGTATACAG
CAGTTTCCCAGTGCACAGTCAGAACAGCCCTCGAATCCCCCTTCAGAGACGCGTCAAGCCAACTCGGAAGAAGCG
AACGGAACTTCAAATGCTAATGTGCTGGCCCCCGGTCGCTCGCCCTGCATGAACTGTGGCACGACTGCTACCCCT
CTATGGAGGCGTGATGCAGATGGAAATCCCGTTTGCAATGCCTGTGGTCTCTACCAGAAAACACGGCATACCAAC
CGACCCGTGAATCTTGGTCGCACTCCGCCACCAGCGAACCCTCCCACATCTCCGTCTTTGAACGCCACAGGAGTA
CCGCCCGGCCCTGCAGCTACCAGCACATCTACATCCCCTAATGCAAAAGGCGCCAAGCCCGTGTCGCCATCAAAC
TCGAATCCGTCCAAGATGAGTGGCACCTGCCCTGGTGACGGTCGTTGCGACGGAACTGGTGGCACATCTGCATGC
TCGGGTTGTCCGACCTACAACAACGCTCTTGCTGCTGGCAGAGTGGGTGTCGAGGCACCGGCTGGCACAGCTGAA
CCTCCTGCTGACACATCTGCCAAGGCTGCTCCTGAGGCTGCTTCCCCTGTGGTGAACGAACCTGATACCAGTACA
ACCACCAGTACAGCAAAGCGCCCTCGGGCTGCCGTAAGCGCGTTGTGTTGTGCCAACTGTGGTACAAGTACGACT
CCCTTATGGCGAAGGGATGATGTGGGCAACAATATCTGCAATGCTTGTGGTCTATACTTCAAGCTGCACGGCACC
CATCGTCCTAACTCAATGAAGAAGACTGTAATAAAGCGGCGAAAGCGCGTTCCCGCTGCTGCAGCTGAAGCCCTC
GTAGCCGTTGGCCGCTATGCTGGTGGAAATGGAGGCAACGGAGAAGAAAGCGACGCTGAGGCACAAGAACCAAAG
AGGAAGCGTACACGCCGCACCCGGGCGTCCCGTGCCGCAGAAAGGGAAGATGAAGATATACCCATGGAAGGCGAT
GAGGAGCATGTCAGTGCTTCGAATCGGAAGAGAAACGGTTGGGATGGTCGATCTGTATCCCCTCAAAATCGTGCA
CCCTCGAGAAGTGATTATATAAGCCGTGGCCCAAACGCACCGGGTCCGTTCGCTCCAACAGGTTCTCCCCACAGT
GGATTCGAAATCCCTTCTCTTGCAGTTCTCGGTAATTCTGCAGCTGCCGCCGCGCTTCTGAATGCGCAATCGAGT
TACATGCGCTCGGGGTCGAATGCACCCAGCCGCACCCATTCACCGCTTGGCCACGGCGCCACGGGTTATCCTCTT
CCACCTGGTGCTCCGTTCTATCCCCCTGATATGGGAATGATTAACTTCAGTTTGGCAGTCGGCAATCTTATGAGT
ATGGGCGTGCCAACACTTCCCGAGCTTGAGCGCCACTATATAGAACTTGGCGAACAAAAACGACGGATGGAGGAG
TTGTTAGAACGGACTGATCGTGTTATGGCTGGTTTGAAAAGAGGAATTGACGAGATGCGCGGTGGAAGCGCTCAG
CAACAAGCACCACCACCCATGGCACCCCCTGCGCAACCTTCCGCCCCTCAAGATGCTCCCGCCCGGGAACCTGAA
GCGGCTCGTGAAGAGCGTGCCTCTCAGCCCGAAGCTCAATCTGCTCCCCAACCGGAGGCTGTTGCAGCTTCTAGT
GGGCCGGAACGCGCTCGCGCGAGCGTGTGGCCTATCGTCGAAGAAACCTCTCGTGATTAA
Gene >Agabi119p4|096770
ATGTCTCCCGTCGTACTCGAGACCCCCGTCATCAACATGCCTAATGCCTCCATTGGCTCCATGGCACGTATACAG
CAGTTTCCCAGTGCACAGTCAGAACAGCCCTCGAATCCCCCTTCAGAGACGCGTCAAGGTTGGTTCTTTTTTCGC
CATGTTCGTCTCGGATCTGTCTCACCTATCGCGTACAATAGCCAACTCGGAAGAAGCGAACGGAACTTCAAATGC
TAATGTGCTGGCCCCCGGTCGCTCGCCCTGCATGAACTGTGGCACGACTGCTACCCCTCTATGGAGGCGTGATGC
AGATGGAAATCCCGTTTGCAATGCCTGTGGTGAGTTTTTCTTAATCTGCCTCTCCCGTTTCATCTTTTCCTCCGG
TCTCCGTCCAAGCGCCGTCATCAATTTCAACCACGTCATACACGTGGTCACAGAATGCTCAGACTGCGCATAACC
CTCCCTTACCCTCTCGCTTCCAATCTTCCCCAATCATAAATTCGCGTTTGTGTTTCGTCTATGACACCATTGTTG
TGCACGAATTCATCTCTTGTGCTCTCCACGCTTATGGCTCGACATGCACTGTCGCCATGCGTCTCCTGGGTGGTA
TCGGTTCACAACGAACTTACCACATCAGTCATACATTAGCATTATCGGTACGCTAAATCTCGCCATATCATCTCT
GCACGGCAGATGATCGAGATGTTGAGTTTCAAGCTCGCGCAGGCAGTTCCCTGTTACCCAGTGCTCTATCCTCGC
GACATTCCTTTGATCACTGCATAACTGCCCTACAAAGCTCTCTTTCATCTATCTATTTGGCATCTTTACGGGCAT
GGACGCGAAAGACTCCTCATCTGGGAGTCGCCTCCCTCGTTCTCGTCGATACTCGCCCTGTTCACCTCCTTCTCA
TCCCCCTCCGAGATCTATATTTCCGTCTCGAACAGTTGACTTACCAGATTATTATCCCCCTCCAGGTCTCTACCA
GAAAACACGGCATACCAACCGACCCGTGAATCTTGGTCGCACTCCGCCACCAGCGAACCCTCCCACATCTCCGTC
TTTGAACGCCACAGGAGTACCGCCCGGCCCTGCAGCTACCAGCACATCTACATCCCCTAATGCAAAAGGCGCCAA
GCCCGTGTCGCCATCAAACTCGAATCCGTCCAAGATGAGTGGCACCTGCCCTGGTGACGGTCGTTGCGACGGAAC
TGGTGGCACATCTGCATGCTCGGGTTGTCCGACCTACAACAACGCTCTTGCTGCTGGCAGAGTGGGTGTCGAGGC
ACCGGCTGGCACAGCTGAACCTCCTGCTGACACATCTGCCAAGGCTGCTCCTGAGGCTGCTTCCCCTGTGGTGAA
CGAACCTGATACCAGTACAACCACCAGTACAGCAAAGCGCCCTCGGGCTGCCGTAAGCGCGTTGTGTTGTGCCAA
CTGTGGTACAAGTACGACTCCCTTATGGCGAAGGGATGATGTGGGCAACAATATCTGCAATGCTTGTGGTAAGTG
AATTAGTTTCTCATTCGTCACTATTTCTGGTTCTCCATCATCTCAACGGTGCTGCGCGTGAGAGATAATCCCACG
CGGGAACCCTTTTTATTCGAATGTCTCGTGATTATCTTTACTCATCTTTACTCTTATCTGATAATCAGGTCTATA
CTTCAAGCTGCACGGCACCCATCGTCCTAACTCAATGAAGAAGACTGTAATAAAGCGGCGAAAGCGCGTTCCCGC
TGCTGCAGGTGCAGCCAGTCCTAGTCCATCTGCTCGCATGACTGATCAGGCAGCAGCTGAAGCCCTCGTAGCCGT
TGGCCGCTATGCTGGTGGAAATGGAGGCAACGGAGAAGAAAGCGACGCTGAGGCACAAGAACCAAAGAGGAAGCG
TACACGCCGCACCCGGGCGTCCCGTGCCGCAGAAAGGGAAGATGAAGATATACCCATGGAAGGCGATGAGGAGCA
TGTCAGTGCTTCGAATCGGAAGAGAAACGGTTGGGATGGTCGATCTGTATCCCCTCAAAATCGTGCACCCTCGAG
AAGTGATTATATAAGCCGTGGCCCAAACGCACCGGGTCCGTTCGCTCCAACAGGTTCTCCCCACAGTGGATTCGA
AATCCCTTCTCTTGCAGTTCTCGGTAATTCTGCAGCTGCCGCCGCGCTTCTGAATGCGCAATCGAGTTACATGCG
CTCGGGGTCGAATGCACCCAGCCGCACCCATTCACCGCTTGGCCACGGCGCCACGGGTTATCCTCTTCCACCTGG
TGCTCCGTTCTATCCCCCTGATATGGGAATGATTAACTTCAGTTTGGCAGTCGGCAATCTTATGAGTATGGGCGT
GCCAACACTTCCCGAGCTTGAGCGCCACTATATAGAACTTGGCGAACAAAAACGACGGATGGAGGAGTTGTTAGA
ACGGACTGATCGTGTTATGGCTGGTTTGAAAAGAGGAATTGACGAGATGCGCGGTGGAAGCGCTCAGCAACAAGC
ACCACCACCCATGGCACCCCCTGCGCAACCTTCCGCCCCTCAAGATGCTCCCGCCCGGGAACCTGAAGCGGCTCG
TGAAGAGCGTGCCTCTCAGCCCGAAGCTCAATCTGCTCCCCAACCGGAGGCTGTTGCAGCTTCTAGTGGGCCGGA
ACGCGCTCGCGCGAGCGTGTGGCCTATCGTCGAAGAAACCTCTCGTGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail