Protein ID | Agabi119p4|096740 |
Gene name | |
Location | scaffold_06:2247479..2249132 |
Strand | - |
Gene length (bp) | 1653 |
Transcript length (bp) | 1410 |
Coding sequence length (bp) | 1410 |
Protein length (aa) | 470 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01960 | ArgJ | ArgJ family | 2.4E-144 | 33 | 469 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|B0D316|ARGJ_LACBS | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_324786 PE=3 SV=1 | 2 | 469 | 0.0E+00 |
sp|A8NAN2|ARGJ_COPC7 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_08401 PE=3 SV=1 | 3 | 469 | 0.0E+00 |
sp|B8PH83|ARGJ_POSPM | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=POSPLDRAFT_134690 PE=3 SV=1 | 13 | 469 | 0.0E+00 |
sp|P0CM20|ARGJ_CRYNJ | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CND03570 PE=3 SV=1 | 11 | 469 | 1.0E-164 |
sp|P0CM21|ARGJ_CRYNB | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBD2760 PE=3 SV=1 | 11 | 469 | 2.0E-164 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|B0D316|ARGJ_LACBS | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_324786 PE=3 SV=1 | 2 | 469 | 0.0E+00 |
sp|A8NAN2|ARGJ_COPC7 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_08401 PE=3 SV=1 | 3 | 469 | 0.0E+00 |
sp|B8PH83|ARGJ_POSPM | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=POSPLDRAFT_134690 PE=3 SV=1 | 13 | 469 | 0.0E+00 |
sp|P0CM20|ARGJ_CRYNJ | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CND03570 PE=3 SV=1 | 11 | 469 | 1.0E-164 |
sp|P0CM21|ARGJ_CRYNB | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBD2760 PE=3 SV=1 | 11 | 469 | 2.0E-164 |
sp|C9S923|ARGJ_VERA1 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_00178 PE=3 SV=1 | 1 | 469 | 3.0E-144 |
sp|A6S146|ARGJ1_BOTFB | Arginine biosynthesis bifunctional protein ArgJ 1, mitochondrial OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_06543 PE=3 SV=1 | 26 | 469 | 4.0E-144 |
sp|D1ZHR9|ARGJ_SORMK | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_03990 PE=3 SV=1 | 26 | 469 | 2.0E-143 |
sp|C4R3R8|ARGJ_PICPG | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr3_0176 PE=3 SV=1 | 11 | 469 | 2.0E-143 |
sp|A7UWD5|ARGJ_NEUCR | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B9K17.150 PE=3 SV=1 | 26 | 469 | 2.0E-142 |
sp|B2B4X6|ARGJ_PODAN | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_2830 PE=3 SV=1 | 9 | 469 | 2.0E-141 |
sp|Q2HAX7|ARGJ_CHAGB | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_02627 PE=3 SV=1 | 3 | 469 | 2.0E-141 |
sp|Q6BKT4|ARGJ_DEBHA | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2F19382g PE=3 SV=3 | 27 | 469 | 3.0E-140 |
sp|C4JMY4|ARGJ_UNCRE | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_04192 PE=3 SV=1 | 26 | 469 | 8.0E-140 |
sp|C5FHS6|ARGJ_ARTOC | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_01725 PE=3 SV=1 | 26 | 469 | 1.0E-139 |
sp|A3LWC0|ARGJ_PICST | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_60752 PE=3 SV=2 | 27 | 469 | 1.0E-138 |
sp|Q4WUE0|ARGJ_ASPFU | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_5G08120 PE=3 SV=1 | 16 | 469 | 9.0E-138 |
sp|B0Y3W4|ARGJ_ASPFC | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_055650 PE=3 SV=1 | 16 | 469 | 9.0E-138 |
sp|A1DF20|ARGJ_NEOFI | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_079180 PE=3 SV=1 | 16 | 469 | 9.0E-138 |
sp|C5P7K2|ARGJ_COCP7 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Coccidioides posadasii (strain C735) GN=CPC735_027380 PE=3 SV=1 | 26 | 469 | 3.0E-137 |
sp|Q0CDB9|ARGJ_ASPTN | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_08315 PE=3 SV=1 | 26 | 469 | 7.0E-137 |
sp|A5DAF0|ARGJ_PICGU | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00255 PE=3 SV=2 | 27 | 469 | 3.0E-135 |
sp|C5K110|ARGJ_AJEDS | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_08504 PE=3 SV=1 | 16 | 469 | 1.0E-134 |
sp|C5GXZ4|ARGJ_AJEDR | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_09234 PE=3 SV=1 | 16 | 469 | 1.0E-134 |
sp|B2VVA8|ARGJ_PYRTR | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_01175 PE=3 SV=1 | 26 | 469 | 2.0E-134 |
sp|B8NEJ3|ARGJ_ASPFN | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_061910 PE=3 SV=1 | 26 | 469 | 4.0E-134 |
sp|A1CAP4|ARGJ_ASPCL | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_012400 PE=3 SV=1 | 16 | 469 | 6.0E-134 |
sp|Q2U7R8|ARGJ_ASPOR | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090701000729 PE=3 SV=1 | 26 | 469 | 6.0E-134 |
sp|Q6C627|ARGJ_YARLI | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E13057g PE=3 SV=1 | 6 | 469 | 7.0E-134 |
sp|C4YTS0|ARGJ_CANAW | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Candida albicans (strain WO-1) GN=CAWG_05565 PE=3 SV=1 | 27 | 469 | 7.0E-134 |
sp|Q5AH38|ARGJ_CANAL | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ECM42 PE=3 SV=1 | 27 | 469 | 8.0E-134 |
sp|A5E7B9|ARGJ_LODEL | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_05508 PE=3 SV=1 | 3 | 469 | 5.0E-133 |
sp|A4R5F6|ARGJ_MAGO7 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_04210 PE=3 SV=2 | 9 | 469 | 8.0E-133 |
sp|B9WK98|ARGJ_CANDC | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_71970 PE=3 SV=1 | 27 | 469 | 3.0E-132 |
sp|Q5AVF8|ARGJ_EMENI | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ornA PE=3 SV=2 | 16 | 469 | 4.0E-132 |
sp|C6HSY8|ARGJ_AJECH | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=HCDG_09319 PE=3 SV=1 | 26 | 469 | 6.0E-132 |
sp|A2QGS5|ARGJ_ASPNC | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An03g04330 PE=3 SV=1 | 16 | 469 | 2.0E-131 |
sp|B6QFZ6|ARGJ_TALMQ | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_083870 PE=3 SV=1 | 19 | 469 | 4.0E-131 |
sp|C0NE02|ARGJ_AJECG | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_02095 PE=3 SV=1 | 26 | 469 | 1.0E-130 |
sp|Q6FU44|ARGJ_CANGA | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0F06501g PE=3 SV=1 | 15 | 469 | 1.0E-130 |
sp|C5E3Y4|ARGJ_ZYGRC | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0E01232g PE=3 SV=1 | 7 | 469 | 5.0E-130 |
sp|B8M9V7|ARGJ_TALSN | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_118750 PE=3 SV=1 | 10 | 469 | 2.0E-129 |
sp|C0SCV8|ARGJ_PARBP | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_05513 PE=3 SV=2 | 26 | 469 | 4.0E-129 |
sp|C1GEZ1|ARGJ_PARBD | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_05827 PE=3 SV=1 | 26 | 469 | 4.0E-129 |
sp|C5DCN3|ARGJ_LACTC | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KLTH0B04488g PE=3 SV=1 | 9 | 469 | 7.0E-129 |
sp|B6JYD2|ARGJ_SCHJY | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_01592 PE=3 SV=1 | 5 | 469 | 4.0E-128 |
sp|C7YUB3|ARGJ_NECH7 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_96275 PE=3 SV=1 | 1 | 469 | 9.0E-128 |
sp|A7TPS8|ARGJ_VANPO | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1073p15 PE=3 SV=1 | 7 | 469 | 1.0E-127 |
sp|O94346|ARGJ_SCHPO | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.14 PE=3 SV=1 | 7 | 469 | 2.0E-127 |
sp|B6HQD4|ARGJ_PENRW | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc22g15960 PE=3 SV=1 | 26 | 461 | 3.0E-126 |
sp|C1H986|ARGJ_PARBA | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_07327 PE=3 SV=1 | 13 | 469 | 4.0E-126 |
sp|Q04728|ARGJ_YEAST | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG7 PE=1 SV=1 | 15 | 469 | 1.0E-125 |
sp|A6ZMC1|ARGJ_YEAS7 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=ARG7 PE=3 SV=1 | 15 | 469 | 1.0E-125 |
sp|B5VPI9|ARGJ_YEAS6 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=ARG7 PE=3 SV=1 | 15 | 469 | 1.0E-125 |
sp|C7GL62|ARGJ_YEAS2 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=ARG7 PE=3 SV=1 | 15 | 469 | 1.0E-125 |
sp|B3LLV5|ARGJ_YEAS1 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ARG7 PE=3 SV=1 | 15 | 469 | 1.0E-125 |
sp|C8ZER4|ARGJ_YEAS8 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ARG7 PE=3 SV=1 | 15 | 469 | 3.0E-125 |
sp|P0CH65|ARGJ_USTMA | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10308 PE=3 SV=1 | 48 | 469 | 2.0E-123 |
sp|Q759Y5|ARGJ_ASHGO | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADR138C PE=3 SV=2 | 2 | 469 | 4.0E-122 |
sp|Q6CII9|ARGJ_KLULA | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F26268g PE=3 SV=1 | 9 | 469 | 5.0E-122 |
sp|C4Y584|ARGJ_CLAL4 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=CLUG_03318 PE=3 SV=1 | 27 | 430 | 2.0E-117 |
sp|A8Q9M0|ARGJ_MALGO | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_3505 PE=3 SV=1 | 4 | 463 | 6.0E-117 |
sp|A7E5P6|ARGJ1_SCLS1 | Arginine biosynthesis bifunctional protein ArgJ 1, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_00621 PE=3 SV=1 | 26 | 469 | 1.0E-116 |
sp|A6R040|ARGJ_AJECN | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_02997 PE=3 SV=1 | 26 | 469 | 6.0E-115 |
sp|C5MG55|ARGJ_CANTT | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CTRG_05048 PE=3 SV=1 | 27 | 413 | 1.0E-102 |
sp|A6S9T6|ARGJ2_BOTFB | Arginine biosynthesis bifunctional protein ArgJ 2, mitochondrial OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_09566 PE=3 SV=1 | 12 | 469 | 3.0E-100 |
sp|D3AXF4|ARGJ_POLPA | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Polysphondylium pallidum GN=PPL_00785 PE=3 SV=1 | 25 | 469 | 6.0E-100 |
sp|A7EDG9|ARGJ2_SCLS1 | Arginine biosynthesis bifunctional protein ArgJ 2, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_03359 PE=3 SV=1 | 11 | 467 | 2.0E-96 |
sp|Q54DY1|ARGJ_DICDI | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Dictyostelium discoideum GN=argJ PE=3 SV=1 | 28 | 469 | 4.0E-96 |
sp|Q8R7B9|ARGJ_CALS4 | Arginine biosynthesis bifunctional protein ArgJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argJ PE=3 SV=1 | 27 | 469 | 4.0E-88 |
sp|Q8CUN1|ARGJ_OCEIH | Arginine biosynthesis bifunctional protein ArgJ OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argJ PE=3 SV=1 | 28 | 469 | 2.0E-87 |
sp|Q9Z4S1|ARGJ_THENN | Arginine biosynthesis bifunctional protein ArgJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=argJ PE=1 SV=2 | 28 | 469 | 1.0E-85 |
sp|P62061|ARGJ_GEOSL | Arginine biosynthesis bifunctional protein ArgJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argJ PE=3 SV=1 | 30 | 469 | 1.0E-84 |
sp|Q9X2A3|ARGJ_THEMA | Arginine biosynthesis bifunctional protein ArgJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argJ PE=3 SV=1 | 28 | 469 | 4.0E-84 |
sp|Q3ZYG4|ARGJ_DEHMC | Arginine biosynthesis bifunctional protein ArgJ OS=Dehalococcoides mccartyi (strain CBDB1) GN=argJ PE=3 SV=1 | 22 | 469 | 2.0E-83 |
sp|P36843|ARGJ_BACSU | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus subtilis (strain 168) GN=argJ PE=3 SV=2 | 26 | 469 | 2.0E-81 |
sp|Q9ZJ14|ARGJ_BACAM | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus amyloliquefaciens GN=argJ PE=3 SV=1 | 26 | 469 | 2.0E-81 |
sp|Q3Z731|ARGJ_DEHM1 | Arginine biosynthesis bifunctional protein ArgJ OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=argJ PE=3 SV=1 | 22 | 467 | 2.0E-81 |
sp|Q65LE9|ARGJ_BACLD | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=argJ PE=3 SV=1 | 28 | 469 | 8.0E-81 |
sp|Q5L1V4|ARGJ_GEOKA | Arginine biosynthesis bifunctional protein ArgJ OS=Geobacillus kaustophilus (strain HTA426) GN=argJ PE=3 SV=1 | 28 | 469 | 5.0E-80 |
sp|Q3A9W1|ARGJ_CARHZ | Arginine biosynthesis bifunctional protein ArgJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=argJ PE=3 SV=1 | 28 | 469 | 3.0E-79 |
sp|Q3ASI6|ARGJ_CHLCH | Arginine biosynthesis bifunctional protein ArgJ OS=Chlorobium chlorochromatii (strain CaD3) GN=argJ PE=3 SV=1 | 51 | 469 | 1.0E-78 |
sp|Q8TX15|ARGJ_METKA | Arginine biosynthesis bifunctional protein ArgJ OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argJ PE=3 SV=1 | 28 | 469 | 1.0E-77 |
sp|Q5M122|ARGJ_STRT1 | Arginine biosynthesis bifunctional protein ArgJ OS=Streptococcus thermophilus (strain CNRZ 1066) GN=argJ PE=3 SV=1 | 28 | 469 | 2.0E-77 |
sp|Q5M5L0|ARGJ_STRT2 | Arginine biosynthesis bifunctional protein ArgJ OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=argJ PE=3 SV=1 | 28 | 469 | 2.0E-77 |
sp|Q07908|ARGJ_GEOSE | Arginine biosynthesis bifunctional protein ArgJ OS=Geobacillus stearothermophilus GN=argJ PE=1 SV=1 | 28 | 469 | 2.0E-77 |
sp|Q8UA56|ARGJ_AGRFC | Arginine biosynthesis bifunctional protein ArgJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=argJ PE=3 SV=1 | 21 | 469 | 1.0E-76 |
sp|P59611|ARGJ_CHLTE | Arginine biosynthesis bifunctional protein ArgJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argJ PE=3 SV=1 | 27 | 469 | 3.0E-75 |
sp|Q6GKC3|ARGJ_STAAR | Arginine biosynthesis bifunctional protein ArgJ OS=Staphylococcus aureus (strain MRSA252) GN=argJ PE=3 SV=1 | 26 | 469 | 3.0E-75 |
sp|Q8NYM7|ARGJ_STAAW | Arginine biosynthesis bifunctional protein ArgJ OS=Staphylococcus aureus (strain MW2) GN=argJ PE=3 SV=1 | 26 | 469 | 3.0E-75 |
sp|Q6GCU3|ARGJ_STAAS | Arginine biosynthesis bifunctional protein ArgJ OS=Staphylococcus aureus (strain MSSA476) GN=argJ PE=3 SV=1 | 26 | 469 | 3.0E-75 |
sp|Q5HJJ0|ARGJ_STAAC | Arginine biosynthesis bifunctional protein ArgJ OS=Staphylococcus aureus (strain COL) GN=argJ PE=3 SV=1 | 26 | 469 | 3.0E-75 |
sp|Q97GH6|ARGJ1_CLOAB | Arginine biosynthesis bifunctional protein ArgJ 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argJ1 PE=3 SV=1 | 31 | 469 | 5.0E-75 |
sp|Q3A246|ARGJ_PELCD | Arginine biosynthesis bifunctional protein ArgJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=argJ PE=3 SV=1 | 30 | 469 | 5.0E-74 |
sp|Q6FED8|ARGJ_ACIAD | Arginine biosynthesis bifunctional protein ArgJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=argJ PE=3 SV=1 | 63 | 469 | 5.0E-74 |
sp|P63576|ARGJ_STAAN | Arginine biosynthesis bifunctional protein ArgJ OS=Staphylococcus aureus (strain N315) GN=argJ PE=3 SV=1 | 26 | 469 | 8.0E-74 |
sp|P63575|ARGJ_STAAM | Arginine biosynthesis bifunctional protein ArgJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argJ PE=3 SV=1 | 26 | 469 | 8.0E-74 |
sp|Q3J7A0|ARGJ_NITOC | Arginine biosynthesis bifunctional protein ArgJ OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=argJ PE=3 SV=1 | 17 | 469 | 9.0E-74 |
sp|Q8CSF9|ARGJ_STAES | Arginine biosynthesis bifunctional protein ArgJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argJ PE=3 SV=1 | 28 | 469 | 1.0E-73 |
sp|Q5HP22|ARGJ_STAEQ | Arginine biosynthesis bifunctional protein ArgJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argJ PE=3 SV=1 | 28 | 469 | 1.0E-73 |
sp|Q67KC5|ARGJ_SYMTH | Arginine biosynthesis bifunctional protein ArgJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=argJ PE=3 SV=1 | 28 | 469 | 1.0E-73 |
sp|Q46X04|ARGJ_CUPPJ | Arginine biosynthesis bifunctional protein ArgJ OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=argJ PE=3 SV=1 | 18 | 469 | 1.0E-73 |
sp|Q8DV45|ARGJ_STRMU | Arginine biosynthesis bifunctional protein ArgJ OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argJ PE=3 SV=1 | 28 | 469 | 1.0E-73 |
sp|Q6AJL0|ARGJ_DESPS | Arginine biosynthesis bifunctional protein ArgJ OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argJ PE=3 SV=1 | 30 | 469 | 1.0E-73 |
sp|Q8XVJ7|ARGJ_RALSO | Arginine biosynthesis bifunctional protein ArgJ OS=Ralstonia solanacearum (strain GMI1000) GN=argJ PE=3 SV=1 | 22 | 469 | 5.0E-73 |
sp|Q92BB8|ARGJ_LISIN | Arginine biosynthesis bifunctional protein ArgJ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argJ PE=3 SV=1 | 28 | 469 | 7.0E-73 |
sp|Q4A0N0|ARGJ_STAS1 | Arginine biosynthesis bifunctional protein ArgJ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=argJ PE=3 SV=1 | 26 | 469 | 1.0E-72 |
sp|Q7UUJ7|ARGJ_RHOBA | Arginine biosynthesis bifunctional protein ArgJ OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=argJ PE=3 SV=1 | 16 | 469 | 2.0E-72 |
sp|P59612|ARGJ_PSEPK | Arginine biosynthesis bifunctional protein ArgJ OS=Pseudomonas putida (strain KT2440) GN=argJ PE=3 SV=1 | 18 | 469 | 5.0E-72 |
sp|Q3K7U0|ARGJ_PSEPF | Arginine biosynthesis bifunctional protein ArgJ OS=Pseudomonas fluorescens (strain Pf0-1) GN=argJ PE=3 SV=1 | 21 | 469 | 8.0E-72 |
sp|Q9CHD4|ARGJ_LACLA | Arginine biosynthesis bifunctional protein ArgJ OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argJ PE=3 SV=1 | 28 | 469 | 1.0E-71 |
sp|Q4ZNZ9|ARGJ_PSEU2 | Arginine biosynthesis bifunctional protein ArgJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=argJ PE=3 SV=1 | 18 | 469 | 1.0E-71 |
sp|Q71Z77|ARGJ_LISMF | Arginine biosynthesis bifunctional protein ArgJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argJ PE=3 SV=1 | 28 | 469 | 2.0E-71 |
sp|Q8Y6U2|ARGJ_LISMO | Arginine biosynthesis bifunctional protein ArgJ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argJ PE=3 SV=1 | 28 | 469 | 2.0E-71 |
sp|Q57645|ARGJ_METJA | Glutamate N-acetyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argJ PE=1 SV=1 | 28 | 469 | 2.0E-71 |
sp|P62060|ARGJ_DESVH | Arginine biosynthesis bifunctional protein ArgJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argJ PE=3 SV=1 | 28 | 469 | 4.0E-71 |
sp|Q48EG7|ARGJ_PSE14 | Arginine biosynthesis bifunctional protein ArgJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=argJ PE=3 SV=1 | 18 | 469 | 5.0E-71 |
sp|Q5NP13|ARGJ_ZYMMO | Arginine biosynthesis bifunctional protein ArgJ OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=argJ PE=3 SV=1 | 88 | 469 | 5.0E-71 |
sp|Q818W0|ARGJ_BACCR | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argJ PE=3 SV=1 | 28 | 469 | 5.0E-71 |
sp|P62057|ARGJ_BACC1 | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=argJ PE=3 SV=1 | 28 | 469 | 6.0E-71 |
sp|Q92MJ1|ARGJ_RHIME | Arginine biosynthesis bifunctional protein ArgJ OS=Rhizobium meliloti (strain 1021) GN=argJ PE=3 SV=2 | 21 | 469 | 8.0E-71 |
sp|Q635F1|ARGJ_BACCZ | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus cereus (strain ZK / E33L) GN=argJ PE=3 SV=1 | 28 | 469 | 1.0E-70 |
sp|Q5P706|ARGJ_AROAE | Arginine biosynthesis bifunctional protein ArgJ OS=Aromatoleum aromaticum (strain EbN1) GN=argJ PE=3 SV=1 | 23 | 469 | 2.0E-70 |
sp|Q9K8V3|ARGJ_BACHD | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argJ PE=1 SV=1 | 30 | 469 | 2.0E-70 |
sp|Q87WZ4|ARGJ_PSESM | Arginine biosynthesis bifunctional protein ArgJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argJ PE=3 SV=1 | 18 | 469 | 6.0E-70 |
sp|Q6HE29|ARGJ_BACHK | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argJ PE=3 SV=1 | 28 | 469 | 6.0E-70 |
sp|Q4K7C2|ARGJ_PSEF5 | Arginine biosynthesis bifunctional protein ArgJ OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=argJ PE=3 SV=1 | 21 | 469 | 7.0E-70 |
sp|Q81M96|ARGJ_BACAN | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus anthracis GN=argJ PE=3 SV=1 | 28 | 469 | 2.0E-69 |
sp|Q6G0Q6|ARGJ_BARQU | Arginine biosynthesis bifunctional protein ArgJ OS=Bartonella quintana (strain Toulouse) GN=argJ PE=3 SV=1 | 59 | 469 | 3.0E-69 |
sp|Q5FQD0|ARGJ_GLUOX | Arginine biosynthesis bifunctional protein ArgJ OS=Gluconobacter oxydans (strain 621H) GN=argJ PE=3 SV=1 | 18 | 469 | 2.0E-68 |
sp|Q607S6|ARGJ_METCA | Arginine biosynthesis bifunctional protein ArgJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=argJ PE=3 SV=1 | 51 | 469 | 3.0E-68 |
sp|Q82SU1|ARGJ_NITEU | Arginine biosynthesis bifunctional protein ArgJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argJ PE=3 SV=1 | 51 | 469 | 4.0E-68 |
sp|Q6G5T6|ARGJ_BARHE | Arginine biosynthesis bifunctional protein ArgJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=argJ PE=3 SV=1 | 30 | 469 | 4.0E-68 |
sp|Q4FSF9|ARGJ_PSYA2 | Arginine biosynthesis bifunctional protein ArgJ OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=argJ PE=3 SV=1 | 22 | 469 | 6.0E-68 |
sp|Q39JW0|ARGJ_BURL3 | Arginine biosynthesis bifunctional protein ArgJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=argJ PE=3 SV=1 | 51 | 469 | 6.0E-68 |
sp|Q47AB5|ARGJ_DECAR | Arginine biosynthesis bifunctional protein ArgJ OS=Dechloromonas aromatica (strain RCB) GN=argJ PE=3 SV=1 | 21 | 469 | 8.0E-68 |
sp|Q486G0|ARGJ_COLP3 | Arginine biosynthesis bifunctional protein ArgJ OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=argJ PE=3 SV=1 | 60 | 469 | 9.0E-68 |
sp|Q7P0T8|ARGJ_CHRVO | Arginine biosynthesis bifunctional protein ArgJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=argJ PE=3 SV=1 | 61 | 469 | 2.0E-67 |
sp|Q8FYE2|ARGJ_BRUSU | Arginine biosynthesis bifunctional protein ArgJ OS=Brucella suis biovar 1 (strain 1330) GN=argJ PE=3 SV=1 | 21 | 469 | 4.0E-67 |
sp|Q57AV8|ARGJ_BRUAB | Arginine biosynthesis bifunctional protein ArgJ OS=Brucella abortus biovar 1 (strain 9-941) GN=argJ PE=3 SV=1 | 21 | 469 | 4.0E-67 |
sp|P62065|ARGJ_METMP | Arginine biosynthesis bifunctional protein ArgJ OS=Methanococcus maripaludis (strain S2 / LL) GN=argJ PE=3 SV=1 | 28 | 469 | 6.0E-67 |
sp|P59610|ARGJ_BRADU | Arginine biosynthesis bifunctional protein ArgJ OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argJ PE=3 SV=1 | 20 | 469 | 1.0E-66 |
sp|A9AB46|ARGJ_METM6 | Arginine biosynthesis bifunctional protein ArgJ OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=argJ PE=3 SV=1 | 28 | 469 | 2.0E-66 |
sp|Q9HW04|ARGJ_PSEAE | Arginine biosynthesis bifunctional protein ArgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argJ PE=3 SV=1 | 18 | 469 | 2.0E-66 |
sp|A4FXT1|ARGJ_METM5 | Arginine biosynthesis bifunctional protein ArgJ OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=argJ PE=3 SV=1 | 50 | 469 | 2.0E-66 |
sp|Q3SMQ9|ARGJ_THIDA | Arginine biosynthesis bifunctional protein ArgJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=argJ PE=3 SV=1 | 17 | 469 | 3.0E-66 |
sp|Q9A3Y4|ARGJ_CAUCR | Arginine biosynthesis bifunctional protein ArgJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argJ PE=3 SV=1 | 60 | 469 | 3.0E-66 |
sp|Q8YJF9|ARGJ_BRUME | Arginine biosynthesis bifunctional protein ArgJ OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=argJ PE=3 SV=1 | 21 | 469 | 5.0E-66 |
sp|Q5WEW8|ARGJ_BACSK | Arginine biosynthesis bifunctional protein ArgJ OS=Bacillus clausii (strain KSM-K16) GN=argJ PE=3 SV=1 | 30 | 469 | 2.0E-65 |
sp|Q3JNE9|ARGJ_BURP1 | Arginine biosynthesis bifunctional protein ArgJ OS=Burkholderia pseudomallei (strain 1710b) GN=argJ PE=3 SV=1 | 51 | 469 | 2.0E-65 |
sp|Q5LWL6|ARGJ_RUEPO | Arginine biosynthesis bifunctional protein ArgJ OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=argJ PE=3 SV=1 | 21 | 469 | 3.0E-65 |
sp|Q62GT9|ARGJ_BURMA | Arginine biosynthesis bifunctional protein ArgJ OS=Burkholderia mallei (strain ATCC 23344) GN=argJ PE=3 SV=1 | 51 | 469 | 3.0E-65 |
sp|Q7U3S6|ARGJ_SYNPX | Arginine biosynthesis bifunctional protein ArgJ OS=Synechococcus sp. (strain WH8102) GN=argJ PE=3 SV=1 | 28 | 467 | 5.0E-65 |
sp|Q63QK7|ARGJ_BURPS | Arginine biosynthesis bifunctional protein ArgJ OS=Burkholderia pseudomallei (strain K96243) GN=argJ PE=3 SV=1 | 51 | 469 | 4.0E-64 |
sp|Q97ET6|ARGJ2_CLOAB | Arginine biosynthesis bifunctional protein ArgJ 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argJ2 PE=3 SV=1 | 27 | 467 | 5.0E-64 |
sp|P74122|ARGJ_SYNY3 | Arginine biosynthesis bifunctional protein ArgJ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argJ PE=3 SV=2 | 28 | 467 | 7.0E-64 |
sp|A6VFI9|ARGJ_METM7 | Arginine biosynthesis bifunctional protein ArgJ OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=argJ PE=3 SV=1 | 28 | 469 | 9.0E-64 |
sp|A6UN66|ARGJ_METVS | Arginine biosynthesis bifunctional protein ArgJ OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=argJ PE=3 SV=1 | 50 | 467 | 3.0E-63 |
sp|O26284|ARGJ_METTH | Arginine biosynthesis bifunctional protein ArgJ OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argJ PE=3 SV=1 | 60 | 467 | 4.0E-63 |
sp|Q47N80|ARGJ_THEFY | Arginine biosynthesis bifunctional protein ArgJ OS=Thermobifida fusca (strain YX) GN=argJ PE=3 SV=1 | 28 | 469 | 4.0E-63 |
sp|Q8G5F0|ARGJ_BIFLO | Arginine biosynthesis bifunctional protein ArgJ OS=Bifidobacterium longum (strain NCC 2705) GN=argJ PE=3 SV=1 | 26 | 469 | 7.0E-63 |
sp|Q98G72|ARGJ_RHILO | Arginine biosynthesis bifunctional protein ArgJ OS=Rhizobium loti (strain MAFF303099) GN=argJ PE=3 SV=1 | 21 | 469 | 2.0E-61 |
sp|Q8DHN4|ARGJ_THEEB | Arginine biosynthesis bifunctional protein ArgJ OS=Thermosynechococcus elongatus (strain BP-1) GN=argJ PE=3 SV=1 | 30 | 469 | 2.0E-61 |
sp|Q9RTQ2|ARGJ_DEIRA | Arginine biosynthesis bifunctional protein ArgJ OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=argJ PE=3 SV=1 | 18 | 469 | 8.0E-60 |
sp|Q5YYF8|ARGJ_NOCFA | Arginine biosynthesis bifunctional protein ArgJ OS=Nocardia farcinica (strain IFM 10152) GN=argJ PE=3 SV=1 | 61 | 469 | 1.0E-59 |
sp|O29118|ARGJ_ARCFU | Arginine biosynthesis bifunctional protein ArgJ OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argJ PE=3 SV=1 | 45 | 467 | 1.0E-59 |
sp|Q8YPF9|ARGJ2_NOSS1 | Arginine biosynthesis bifunctional protein ArgJ 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argJ2 PE=3 SV=1 | 22 | 469 | 2.0E-59 |
sp|C5WPC2|ARGJ_SORBI | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Sorghum bicolor GN=Sb01g039230 PE=3 SV=1 | 30 | 467 | 2.0E-59 |
sp|Q7VSW3|ARGJ_BORPE | Arginine biosynthesis bifunctional protein ArgJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argJ PE=3 SV=1 | 13 | 469 | 3.0E-59 |
sp|Q7W3S6|ARGJ_BORPA | Arginine biosynthesis bifunctional protein ArgJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argJ PE=3 SV=1 | 13 | 469 | 5.0E-59 |
sp|Q7WF54|ARGJ_BORBR | Arginine biosynthesis bifunctional protein ArgJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argJ PE=3 SV=1 | 13 | 469 | 5.0E-59 |
sp|C0PF72|ARGJ_MAIZE | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Zea mays PE=2 SV=1 | 30 | 467 | 6.0E-59 |
sp|P62064|ARGJ_RHOPA | Arginine biosynthesis bifunctional protein ArgJ OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=argJ PE=3 SV=1 | 51 | 469 | 1.0E-58 |
sp|Q7VEF9|ARGJ_PROMA | Arginine biosynthesis bifunctional protein ArgJ OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argJ PE=3 SV=1 | 28 | 467 | 4.0E-58 |
sp|O08319|ARGJ_LACPL | Arginine biosynthesis bifunctional protein ArgJ OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argJ PE=3 SV=2 | 26 | 469 | 1.0E-57 |
sp|Q9CC14|ARGJ_MYCLE | Arginine biosynthesis bifunctional protein ArgJ OS=Mycobacterium leprae (strain TN) GN=argJ PE=3 SV=1 | 28 | 469 | 3.0E-57 |
sp|Q7V436|ARGJ_PROMM | Arginine biosynthesis bifunctional protein ArgJ OS=Prochlorococcus marinus (strain MIT 9313) GN=argJ PE=3 SV=1 | 16 | 469 | 8.0E-57 |
sp|P63574|ARGJ_NEIMB | Arginine biosynthesis bifunctional protein ArgJ OS=Neisseria meningitidis serogroup B (strain MC58) GN=argJ PE=3 SV=1 | 30 | 469 | 1.0E-56 |
sp|P63573|ARGJ_NEIMA | Arginine biosynthesis bifunctional protein ArgJ OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argJ PE=3 SV=1 | 30 | 469 | 1.0E-56 |
sp|Q9ZUR7|ARGJ_ARATH | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Arabidopsis thaliana GN=At2g37500 PE=1 SV=2 | 30 | 469 | 1.0E-56 |
sp|Q5MZY1|ARGJ_SYNP6 | Arginine biosynthesis bifunctional protein ArgJ OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argJ PE=3 SV=1 | 28 | 467 | 2.0E-56 |
sp|O67100|ARGJ_AQUAE | Arginine biosynthesis bifunctional protein ArgJ OS=Aquifex aeolicus (strain VF5) GN=argJ PE=3 SV=1 | 58 | 469 | 5.0E-56 |
sp|Q7MAC9|ARGJ_WOLSU | Arginine biosynthesis bifunctional protein ArgJ OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argJ PE=3 SV=1 | 28 | 469 | 6.0E-56 |
sp|Q8PZL8|ARGJ_METMA | Arginine biosynthesis bifunctional protein ArgJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argJ PE=3 SV=2 | 39 | 467 | 2.0E-55 |
sp|Q5F7I3|ARGJ_NEIG1 | Arginine biosynthesis bifunctional protein ArgJ OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argJ PE=3 SV=1 | 30 | 469 | 5.0E-55 |
sp|P62063|ARGJ_MYCPA | Arginine biosynthesis bifunctional protein ArgJ OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=argJ PE=3 SV=1 | 62 | 469 | 5.0E-55 |
sp|Q8TK55|ARGJ_METAC | Arginine biosynthesis bifunctional protein ArgJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argJ PE=3 SV=1 | 39 | 469 | 6.0E-55 |
sp|Q4JW03|ARGJ_CORJK | Arginine biosynthesis bifunctional protein ArgJ OS=Corynebacterium jeikeium (strain K411) GN=argJ PE=3 SV=1 | 26 | 469 | 1.0E-54 |
sp|Q7NE46|ARGJ_GLOVI | Arginine biosynthesis bifunctional protein ArgJ OS=Gloeobacter violaceus (strain PCC 7421) GN=argJ PE=3 SV=1 | 30 | 469 | 2.0E-54 |
sp|Q3C251|ARGJ_CITLA | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Citrullus lanatus PE=1 SV=1 | 30 | 467 | 3.0E-54 |
sp|Q46I07|ARGJ_PROMT | Arginine biosynthesis bifunctional protein ArgJ OS=Prochlorococcus marinus (strain NATL2A) GN=argJ PE=3 SV=1 | 28 | 467 | 6.0E-54 |
sp|P38434|ARGJ_NEIGO | Arginine biosynthesis bifunctional protein ArgJ OS=Neisseria gonorrhoeae GN=argJ PE=3 SV=1 | 30 | 469 | 7.0E-54 |
sp|P9WPZ3|ARGJ_MYCTU | Arginine biosynthesis bifunctional protein ArgJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=argJ PE=1 SV=1 | 28 | 469 | 4.0E-53 |
sp|P9WPZ2|ARGJ_MYCTO | Arginine biosynthesis bifunctional protein ArgJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=argJ PE=3 SV=1 | 28 | 469 | 4.0E-53 |
sp|P63572|ARGJ_MYCBO | Arginine biosynthesis bifunctional protein ArgJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=argJ PE=3 SV=1 | 28 | 469 | 4.0E-53 |
sp|P96426|ARGJ_RHOFA | Arginine biosynthesis bifunctional protein ArgJ OS=Rhodococcus fascians GN=argJ PE=3 SV=1 | 28 | 467 | 4.0E-53 |
sp|P62062|ARGJ_LEPIC | Arginine biosynthesis bifunctional protein ArgJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=argJ PE=3 SV=1 | 27 | 469 | 7.0E-53 |
sp|Q8EYV8|ARGJ_LEPIN | Arginine biosynthesis bifunctional protein ArgJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=argJ PE=3 SV=1 | 27 | 469 | 7.0E-53 |
sp|Q8YVA8|ARGJ1_NOSS1 | Arginine biosynthesis bifunctional protein ArgJ 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argJ1 PE=3 SV=1 | 28 | 467 | 1.0E-52 |
sp|Q93EJ3|ARGJ_HELHP | Arginine biosynthesis bifunctional protein ArgJ OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=argJ PE=3 SV=2 | 28 | 469 | 1.0E-52 |
sp|Q3SVN6|ARGJ_NITWN | Arginine biosynthesis bifunctional protein ArgJ OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=argJ PE=3 SV=1 | 51 | 469 | 2.0E-52 |
sp|Q10N79|ARGJ_ORYSJ | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0279400 PE=2 SV=1 | 30 | 467 | 2.0E-52 |
sp|B8AL33|ARGJ_ORYSI | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_11009 PE=3 SV=1 | 30 | 467 | 2.0E-52 |
sp|B9SZB6|ARGJ_RICCO | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Ricinus communis GN=RCOM_1202350 PE=3 SV=1 | 30 | 469 | 4.0E-52 |
sp|A9SLE5|ARGJ_PHYPA | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_213576 PE=3 SV=1 | 30 | 469 | 2.0E-51 |
sp|Q8CK24|ARGJ_STRCO | Arginine biosynthesis bifunctional protein ArgJ OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argJ PE=1 SV=1 | 30 | 469 | 2.0E-51 |
sp|P96137|ARGJ_THET2 | Arginine biosynthesis bifunctional protein ArgJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argJ PE=3 SV=2 | 27 | 467 | 5.0E-51 |
sp|B9NAN0|ARGJ_POPTR | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_746969 PE=3 SV=2 | 30 | 469 | 6.0E-51 |
sp|Q5SJ18|ARGJ_THET8 | Arginine biosynthesis bifunctional protein ArgJ OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argJ PE=3 SV=1 | 27 | 467 | 9.0E-50 |
sp|A4S1K1|ARGJ_OSTLU | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_33128 PE=3 SV=1 | 22 | 469 | 2.0E-49 |
sp|Q828A5|ARGJ_STRAW | Arginine biosynthesis bifunctional protein ArgJ OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argJ PE=3 SV=1 | 30 | 469 | 4.0E-47 |
sp|Q59280|ARGJ_CORGL | Arginine biosynthesis bifunctional protein ArgJ OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argJ PE=3 SV=2 | 28 | 469 | 1.0E-46 |
sp|P62058|ARGJ_CORCT | Arginine biosynthesis bifunctional protein ArgJ OS=Corynebacterium crenatum GN=argJ PE=3 SV=1 | 28 | 469 | 1.0E-45 |
sp|Q7V3M5|ARGJ_PROMP | Arginine biosynthesis bifunctional protein ArgJ OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argJ PE=3 SV=1 | 28 | 467 | 1.0E-45 |
sp|Q9LCS7|ARGJ1_STRC2 | Arginine biosynthesis bifunctional protein ArgJ 1 OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=argJ1 PE=3 SV=1 | 28 | 469 | 2.0E-44 |
sp|P0DJQ5|GNAT2_STRCL | Glutamate N-acetyltransferase 2 OS=Streptomyces clavuligerus GN=oat2 PE=1 SV=1 | 48 | 467 | 3.0E-44 |
sp|P0DJQ6|ARGJ3_STRC2 | Arginine biosynthesis bifunctional protein ArgJ 3 OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=argJ3 PE=3 SV=1 | 48 | 467 | 3.0E-44 |
sp|P62059|ARGJ_CORDI | Arginine biosynthesis bifunctional protein ArgJ OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=argJ PE=3 SV=1 | 28 | 469 | 8.0E-44 |
sp|Q8FTN4|ARGJ_COREF | Arginine biosynthesis bifunctional protein ArgJ OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argJ PE=3 SV=1 | 28 | 469 | 1.0E-43 |
sp|A5AEC8|ARGJ_VITVI | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic OS=Vitis vinifera GN=VITISV_037692 PE=3 SV=1 | 30 | 467 | 6.0E-41 |
sp|D0N1U4|ARGJ_PHYIT | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_04698 PE=3 SV=1 | 59 | 469 | 1.0E-38 |
sp|B8BVB6|ARGJ_THAPS | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Thalassiosira pseudonana GN=THAPSDRAFT_2779 PE=3 SV=1 | 52 | 469 | 9.0E-38 |
sp|P62252|ARGJ2_STRC2 | Arginine biosynthesis bifunctional protein ArgJ 2 OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=argJ2 PE=3 SV=1 | 26 | 464 | 2.0E-28 |
GO Term | Description | Terminal node |
---|---|---|
GO:0004358 | glutamate N-acetyltransferase activity | Yes |
GO:0006526 | arginine biosynthetic process | Yes |
GO:1901607 | alpha-amino acid biosynthetic process | No |
GO:0043436 | oxoacid metabolic process | No |
GO:0006520 | cellular amino acid metabolic process | No |
GO:1901605 | alpha-amino acid metabolic process | No |
GO:0008652 | cellular amino acid biosynthetic process | No |
GO:0044238 | primary metabolic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0019752 | carboxylic acid metabolic process | No |
GO:0009058 | biosynthetic process | No |
GO:0016410 | N-acyltransferase activity | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0008152 | metabolic process | No |
GO:0016740 | transferase activity | No |
GO:0003674 | molecular_function | No |
GO:0016746 | acyltransferase activity | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0009064 | glutamine family amino acid metabolic process | No |
GO:0046394 | carboxylic acid biosynthetic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0016053 | organic acid biosynthetic process | No |
GO:0008080 | N-acetyltransferase activity | No |
GO:0044281 | small molecule metabolic process | No |
GO:0008150 | biological_process | No |
GO:0006082 | organic acid metabolic process | No |
GO:0009084 | glutamine family amino acid biosynthetic process | No |
GO:0016407 | acetyltransferase activity | No |
GO:0044237 | cellular metabolic process | No |
GO:0006525 | arginine metabolic process | No |
GO:0003824 | catalytic activity | No |
GO:0071704 | organic substance metabolic process | No |
GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups | No |
GO:0009987 | cellular process | No |
GO:0044283 | small molecule biosynthetic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 19 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Agabi119p4|096740 MALVFRRWASSTPSKAHLHKPLPENSFPIGYKLTGIHVGVKKNKEILDLGVVLSTSQHPTSAAACFTRNAFKAAP VIVSDNVLARNGGRARGFVVNSGCANAVTGKQGLEDAWAMVKHTTALLPSQAAKEDTEHDALVMSTGVIGQNLPI SKIVAGIRRAADSLGSDFAAWERAAKAFMTTDTFPKLRSRVFSIKGVEYRLAGMDKGAGMIHPDMGPLSTIPSSP RQLHATLLGCILTDAAVSPRSLQSALTYAVDRSFNSISVDGDMSTNDTIIVLANGAAAPIRDGRAHEIDEETDRD SYEIFKKELTDFAVDLAQLVVRDGEGATKFVAVKVQGAPNYKDAHAIASKISTSALVKTALYGEDANWGRILAAT GSVPLSSSPNSEEVPVINPSKVSVTFVPSDGTAELPVLVNGEPENVDEDRAKQILSMEDINIVVDLGLGGDGEAT YWTCDFSYEYVRINGDYRS* |
Coding | >Agabi119p4|096740 ATGGCCCTCGTCTTTCGTCGCTGGGCATCTTCCACTCCCTCGAAAGCTCATCTGCATAAACCTCTGCCCGAAAAC TCGTTTCCAATTGGATACAAGCTCACCGGGATACACGTTGGTGTCAAGAAAAACAAGGAAATACTCGATTTGGGT GTTGTTCTGTCAACATCACAACATCCCACCTCCGCTGCTGCATGCTTCACGCGAAACGCCTTCAAAGCTGCTCCG GTCATCGTCTCAGACAATGTGCTGGCTCGTAACGGGGGTAGGGCCCGTGGTTTCGTAGTCAACAGCGGCTGTGCC AACGCAGTCACCGGTAAACAAGGACTAGAAGATGCGTGGGCCATGGTCAAGCATACCACGGCCCTTCTTCCATCG CAAGCAGCAAAAGAAGATACCGAGCACGATGCCCTCGTCATGTCCACAGGAGTCATAGGCCAGAATCTTCCCATC TCCAAAATCGTCGCCGGTATCCGGCGAGCAGCCGACTCACTTGGTTCCGACTTCGCTGCCTGGGAGCGAGCAGCC AAAGCTTTTATGACAACGGATACTTTCCCGAAATTACGCTCGCGAGTGTTCTCTATCAAAGGAGTCGAGTACAGG TTAGCTGGGATGGACAAAGGTGCTGGGATGATCCATCCTGACATGGGTCCGCTTTCGACCATTCCATCCTCCCCC CGTCAGCTTCATGCGACACTTCTTGGCTGCATCTTGACGGACGCCGCCGTTTCGCCACGTAGCCTGCAGAGCGCT TTGACGTATGCCGTGGACAGAAGTTTTAATTCTATTAGCGTTGATGGTGACATGTCAACCAATGATACTATCATC GTACTCGCCAACGGTGCTGCCGCTCCTATCCGTGATGGTCGTGCCCATGAGATTGATGAAGAAACGGATCGTGAT TCATACGAGATCTTCAAAAAGGAGTTGACCGATTTCGCCGTGGACTTGGCTCAACTGGTTGTCCGAGACGGAGAA GGTGCCACGAAATTCGTTGCCGTCAAAGTACAGGGCGCCCCGAATTACAAGGATGCTCATGCTATTGCCTCAAAG ATCTCAACTTCGGCTCTGGTTAAAACAGCTTTGTACGGCGAAGATGCAAATTGGGGTCGGATTCTTGCGGCTACC GGTTCCGTTCCTCTCTCTTCCTCTCCAAACTCAGAGGAGGTACCGGTTATCAACCCCTCGAAAGTTTCAGTAACT TTCGTACCCTCCGATGGGACCGCAGAGCTCCCCGTTTTGGTCAACGGCGAACCAGAAAATGTCGATGAAGACCGG GCGAAGCAGATCTTGAGTATGGAGGATATAAACATTGTCGTCGACCTCGGACTGGGTGGTGATGGTGAAGCGACA TATTGGACTTGCGATTTCAGTTATGAATATGTGAGGATCAATGGGGATTACAGGAGCTAG |
Transcript | >Agabi119p4|096740 ATGGCCCTCGTCTTTCGTCGCTGGGCATCTTCCACTCCCTCGAAAGCTCATCTGCATAAACCTCTGCCCGAAAAC TCGTTTCCAATTGGATACAAGCTCACCGGGATACACGTTGGTGTCAAGAAAAACAAGGAAATACTCGATTTGGGT GTTGTTCTGTCAACATCACAACATCCCACCTCCGCTGCTGCATGCTTCACGCGAAACGCCTTCAAAGCTGCTCCG GTCATCGTCTCAGACAATGTGCTGGCTCGTAACGGGGGTAGGGCCCGTGGTTTCGTAGTCAACAGCGGCTGTGCC AACGCAGTCACCGGTAAACAAGGACTAGAAGATGCGTGGGCCATGGTCAAGCATACCACGGCCCTTCTTCCATCG CAAGCAGCAAAAGAAGATACCGAGCACGATGCCCTCGTCATGTCCACAGGAGTCATAGGCCAGAATCTTCCCATC TCCAAAATCGTCGCCGGTATCCGGCGAGCAGCCGACTCACTTGGTTCCGACTTCGCTGCCTGGGAGCGAGCAGCC AAAGCTTTTATGACAACGGATACTTTCCCGAAATTACGCTCGCGAGTGTTCTCTATCAAAGGAGTCGAGTACAGG TTAGCTGGGATGGACAAAGGTGCTGGGATGATCCATCCTGACATGGGTCCGCTTTCGACCATTCCATCCTCCCCC CGTCAGCTTCATGCGACACTTCTTGGCTGCATCTTGACGGACGCCGCCGTTTCGCCACGTAGCCTGCAGAGCGCT TTGACGTATGCCGTGGACAGAAGTTTTAATTCTATTAGCGTTGATGGTGACATGTCAACCAATGATACTATCATC GTACTCGCCAACGGTGCTGCCGCTCCTATCCGTGATGGTCGTGCCCATGAGATTGATGAAGAAACGGATCGTGAT TCATACGAGATCTTCAAAAAGGAGTTGACCGATTTCGCCGTGGACTTGGCTCAACTGGTTGTCCGAGACGGAGAA GGTGCCACGAAATTCGTTGCCGTCAAAGTACAGGGCGCCCCGAATTACAAGGATGCTCATGCTATTGCCTCAAAG ATCTCAACTTCGGCTCTGGTTAAAACAGCTTTGTACGGCGAAGATGCAAATTGGGGTCGGATTCTTGCGGCTACC GGTTCCGTTCCTCTCTCTTCCTCTCCAAACTCAGAGGAGGTACCGGTTATCAACCCCTCGAAAGTTTCAGTAACT TTCGTACCCTCCGATGGGACCGCAGAGCTCCCCGTTTTGGTCAACGGCGAACCAGAAAATGTCGATGAAGACCGG GCGAAGCAGATCTTGAGTATGGAGGATATAAACATTGTCGTCGACCTCGGACTGGGTGGTGATGGTGAAGCGACA TATTGGACTTGCGATTTCAGTTATGAATATGTGAGGATCAATGGGGATTACAGGAGCTAG |
Gene | >Agabi119p4|096740 ATGGCCCTCGTCTTTCGTCGCTGGGCATCTTCCACTCCCTCGAAAGCTCATCTGCATAAACCTCTGCCCGAAAAC TCGTTTCCAATTGGATACAAGCTCACCGGGATACACGTTGGTGTCAAGAAAAACAAGGAAATACTCGATTTGGGT GTTGTTCTGTCAACATCACAACATCCCACCTCCGCTGCTGCATGCTTCACGCGAAACGCCTTCAAAGCTGCTCCG GTCATCGTCTCAGACAATGTGCTGGCTCGTAACGGGGGTAGGGCCCGTGGTTTCGTAGTCAACAGCGGCTGTGCC AACGCAGTCACCGGTAAACAAGGACTAGAAGATGCGTGGGCCATGGTCAAGCATACCACGGCCCTTCTTCCATCG CAAGCAGCAAAAGAAGATACCGAGCACGATGCCCTCGTCATGTCCACAGGAGTCATAGGCCAGAATCTTCCCATC TCCAAAATCGTCGCCGGTATCCGGCGAGCAGCCGACTCACTTGGTTCCGACTTCGCTGCCTGGGAGCGAGCAGCC AAAGCTTTTATGACAACGGATACTTTCCCGAAATTACGCTCGCGAGTGTTCTCTATCAAAGGAGTCGAGTACAGG TTAGCTGGGATGGACAAAGGTGCTGGGATGATCCATCCTGACATGGGTCCGCTTTCGACCATTCCATCCTCCCCC CGTCAGCTTCATGCGACACTTCTTGGCTGCATCTTGACGGACGCCGCCGTTTCGCCACGTAGCCTGCAGAGCGCT TTGACGTATGCCGTGGACAGAAGTTTTAATTCTATTAGCGTTGATGGTGACATGTCAACCAATGATACTATCATC GTACTCGCCAACGGTGCTGCCGCTCCTATCCGTGATGGTCGTGCCCATGAGATTGATGAAGAAACGGATCGTGAT TCATACGAGATCTTCAAAAAGGAGTTGACCGATTTCGCCGTGGACTTGGCTCAACTGGTTGTCCGAGACGGAGAA GGTGCCACGAAATTCGTTGCCGTCAAAGTACAGGTGCGTACATACTTGCTAATTGTTGTTTTCTTTCTCTGATCT ATATTTCGAATCGCAATCATATGTCCAGGGCGCCCCGAATTACAAGGATGCTCATGCTATTGCCTCAAAGATCTC AACTTCGGCTCTGGTTAAAACAGCTTTGTACGGCGAAGATGCAAAGTAAGCCGCTCCCGTACTCGCGCCAGTAGC TCCTACTAATTCTCACTGCTTCTTCTCCTGTGGCTGCTCCTATATCTTCCCAATCACGATTTTTCATCTGAAATC GTAAACAATCAGTTGGGGTCGGATTCTTGCGGCTACCGGTTCCGTTCCTCTCTCTTCCTCTCCAAACTCAGAGGA GGTACCGGTTATCAACCCCTCGAAAGTTTCAGTAACTTTCGTACCCTCCGATGGGACCGCAGAGCTCCCCGTTTT GGTCAACGGCGAACCAGAAAATGTCGATGAAGACCGGGCGAAGCAGATCTTGAGTATGGAGGATATAAACATTGT CGTCGACCTCGGACTGGGTGGTGATGGTGAAGCGACATATTGGACTTGCGATTTCAGTTATGTGAGTAACCATTT GCATCTGCTCAATTTTGATGGTGCTAATAGAATGATGTGTAGGAATATGTGAGGATCAATGGGGATTACAGGAGC TAG |