Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|096290
Gene name
Locationscaffold_06:2123947..2128288
Strand-
Gene length (bp)4341
Transcript length (bp)3951
Coding sequence length (bp)3951
Protein length (aa) 1317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain 1.0E-12 740 811

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O18973|RABX5_BOVIN Rab5 GDP/GTP exchange factor OS=Bos taurus GN=RABGEF1 PE=1 SV=1 744 889 8.0E-10
sp|Q9JM13|RABX5_MOUSE Rab5 GDP/GTP exchange factor OS=Mus musculus GN=Rabgef1 PE=1 SV=1 744 889 2.0E-09
sp|Q9UJ41|RABX5_HUMAN Rab5 GDP/GTP exchange factor OS=Homo sapiens GN=RABGEF1 PE=1 SV=2 744 889 3.0E-09
sp|Q9LT31|VPS9A_ARATH Vacuolar protein sorting-associated protein 9A OS=Arabidopsis thaliana GN=VPS9A PE=1 SV=1 750 820 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|096290
MDGHPQFPATSLSRSTGHRLQASTTQELHPLSSSPPVTDIAGFNSAQKYKPYTPRTRVVPATTTNTLVHPPSPSP
VAGEDATSKLQLTKAKSEAQNLGLDTSSIGWAILEKVVAESETGELWADVWSSVASGQATILLPAEPLSTHDKLT
PEFLKDHIAYCDTSSNDQARKSAPIVTLSGLRGTIHGNRLIFSTTLHPLSTAFQSLRDPVTRSSSLNKLPSLPSI
TTSLETSTYPEFRVLNGPTTLPLPPRAPAPPKPPLPPRPGARPLANTAGSSTPSAPTSSSRIPNPFASLFGGGGH
RHSTSTSSTTSGVFGSPTPSIRSNDLLPITPAADPVSQTVEVSAIIIDKKLDRKVIGKMMNEALSKEIKAMLNGQ
DVPRWVALRVTEFCQPWFPFIRAPKIISASLSKSTTKQVKEDKEKDATVLPEWNVNPDRTDGEASIEDKMDFVQE
FYMQLEEGLRVDLGLNNEGHFDQNGDVEKEMMEKMELSATRVRNIMELVERTICSLFYDRLFMQPQSDDSQHDTA
LSNRVAALNLLDLTLEHLDIEISETSTIPKINNIVRACGQRLSDLEDVRAPKDKARILVDAHQIVVDGLSKLPPI
RLMSAEESKALRERLQQQQATAAAAAANANPNTVTPPPVGPQVLLTTSSPERYAMAATPTSTTTPMTTTTTTATV
ESTTTALLATEEGGTASPRTGSAEMTHGAELSPLSFSTKETLSSESPSRSSSPTIDKDDESQKKKMKKKPTPVSS
DILLPMIIFSVVKSNPPHLVSSLLYTQRFRNQSAFMQEGNGGESFCLINLVAVAEFLENVDLEGLGLGSAADTSA
TELSPIITRPPTPFAPSVPTTPKSIASGIDLRGKVEQRVDAIAGSANKVFSGVVDSSFGILKSLLPHQQQEGGVF
DSMTTTTTTITTGPDGKSTMMVGDGAVDAPVMAKSGQGFGLLRRETSGFSIASIISRTRVQQQGEDGQQLVDVGS
SRPGSLRSFRDEGSEDEDEDEDEDDEEDMEEEDGEEYSDDDSDDDEEGDGGEEDNADMRSDYSAREFGESEDEEN
RTQTGINIPGIQITSKSSSPYMSKGPSQSASSFGTDTRSIRSFESMMSEGKKRQQQKKMKMKKKIKQKVKKANER
ERKEREKVEKGNSGGKDVRLGREPRKSISDRLASVSALVGGLNKTSSPPPESRHSSFLQPPTNIVAPIPVHARLS
ISPSSSRAPSPSATSRSPSPLAKTLPGTNMTTAPMTRVREPSAEFPLPLPVPRSSTLPIPSTTTSQSQNMQARVL
PQPNRRFMECASVEELRIGEVGELLEEYRKLVEGVRSLGLI*
Coding >Agabi119p4|096290
ATGGACGGCCATCCTCAGTTCCCAGCCACTTCCTTGTCCAGGTCTACCGGCCATCGCCTGCAGGCTTCTACCACG
CAGGAACTTCATCCGCTTAGCTCTAGCCCTCCTGTAACCGATATTGCGGGGTTCAACAGCGCGCAGAAATACAAG
CCTTATACCCCAAGAACCCGTGTAGTCCCAGCTACAACCACCAACACTCTTGTGCATCCTCCATCTCCTTCACCT
GTCGCTGGCGAAGATGCCACTTCTAAGCTCCAACTTACGAAAGCCAAGTCTGAGGCTCAGAACCTCGGACTAGAC
ACGTCTAGTATCGGATGGGCCATCCTTGAAAAAGTCGTCGCTGAGAGCGAAACGGGAGAACTGTGGGCAGATGTT
TGGTCATCGGTTGCGAGTGGGCAGGCAACCATCTTGTTACCTGCAGAACCTCTGTCGACGCATGATAAACTTACT
CCCGAGTTTTTGAAAGATCATATCGCCTATTGTGATACATCGTCTAATGATCAGGCCCGGAAATCAGCACCTATC
GTCACCCTCTCAGGCCTTCGCGGAACCATACATGGAAACCGCTTAATATTCTCCACAACGCTTCATCCTTTATCG
ACGGCTTTCCAATCTCTTCGAGATCCAGTCACACGATCCTCATCTCTTAACAAGCTACCTTCTCTACCATCAATC
ACTACGTCTTTAGAGACTTCAACATACCCTGAGTTTAGGGTATTGAATGGTCCCACGACATTACCACTCCCACCT
CGAGCTCCTGCACCTCCGAAACCCCCTCTTCCTCCAAGACCGGGCGCAAGACCACTTGCTAATACTGCAGGTTCC
TCTACGCCATCCGCACCAACTTCGTCATCACGCATTCCTAATCCTTTCGCCTCTCTCTTCGGTGGTGGAGGACAT
CGTCATTCCACTTCCACTTCTTCAACAACATCAGGAGTATTTGGTTCTCCTACACCATCAATACGAAGTAATGAT
TTACTTCCGATAACGCCTGCAGCAGATCCCGTATCTCAAACCGTCGAAGTCAGCGCTATCATCATTGATAAAAAG
TTGGATAGGAAGGTCATAGGGAAGATGATGAATGAGGCTTTATCAAAAGAAATCAAAGCTATGTTGAATGGTCAA
GATGTTCCGAGATGGGTTGCTTTGAGGGTAACTGAATTTTGTCAACCTTGGTTTCCATTCATTCGCGCCCCCAAA
ATCATTTCTGCCTCCCTCTCTAAATCTACAACAAAACAAGTAAAAGAGGATAAAGAGAAAGATGCGACGGTGTTG
CCGGAATGGAATGTTAATCCGGATAGGACGGATGGAGAGGCGTCGATTGAAGATAAAATGGATTTTGTGCAGGAG
TTTTATATGCAACTTGAAGAAGGTTTGAGAGTTGATTTGGGATTGAATAATGAAGGGCATTTTGATCAGAATGGA
GATGTGGAAAAGGAAATGATGGAGAAGATGGAATTGTCTGCGACGAGGGTTAGAAATATAATGGAACTCGTTGAA
CGGACGATATGTTCGTTATTCTATGACCGGTTATTTATGCAACCTCAATCCGACGACTCGCAACATGATACGGCA
CTTTCGAATCGCGTAGCAGCTCTAAATCTCCTTGATCTCACTCTCGAACACCTCGATATCGAAATCAGTGAAACG
AGTACTATACCGAAAATCAATAATATCGTTCGTGCTTGTGGTCAAAGATTGAGTGATTTGGAGGATGTGAGGGCA
CCGAAGGATAAAGCTAGAATTTTGGTTGATGCTCATCAGATTGTCGTTGATGGGTTATCGAAATTGCCGCCTATA
AGACTTATGTCAGCTGAAGAATCGAAAGCTCTTCGAGAACGATTACAGCAACAACAAGCTACGGCAGCGGCAGCG
GCAGCCAATGCTAATCCTAATACTGTCACACCACCACCTGTTGGACCTCAAGTTTTATTGACGACGAGTTCTCCT
GAAAGATATGCTATGGCGGCTACTCCGACTAGTACGACCACGCCTATGACTACTACTACTACTACTGCGACTGTG
GAATCTACCACTACTGCGCTTCTGGCAACTGAGGAAGGTGGGACGGCTTCGCCGAGAACTGGAAGTGCGGAAATG
ACCCATGGGGCGGAACTTTCGCCGTTGTCGTTTTCGACGAAGGAGACTTTGTCTTCGGAATCGCCTTCTCGGTCT
TCATCACCTACGATAGATAAAGACGATGAATCTCAGAAGAAGAAGATGAAGAAGAAACCGACACCCGTTTCTTCG
GATATTCTCTTACCCATGATCATATTCTCAGTCGTCAAATCTAATCCTCCTCACCTCGTTTCGAGTTTACTTTAT
ACTCAACGATTTCGGAATCAGAGTGCGTTTATGCAAGAGGGGAATGGGGGAGAGAGTTTTTGTTTGATTAATTTG
GTGGCTGTTGCTGAGTTTTTGGAAAATGTGGATTTGGAGGGACTTGGGTTAGGGTCGGCGGCTGATACCAGTGCG
ACGGAGTTGTCACCGATTATAACGAGACCTCCTACACCATTTGCTCCTTCTGTACCAACGACACCGAAAAGTATC
GCTTCGGGTATAGATCTGAGAGGGAAAGTTGAACAACGAGTGGATGCTATTGCTGGATCGGCGAATAAAGTGTTT
TCGGGGGTGGTGGATTCTTCCTTTGGGATTTTGAAGTCTTTGTTACCGCATCAACAGCAGGAAGGAGGAGTTTTC
GATTCTATGACAACTACAACTACTACTATTACTACTGGGCCAGATGGTAAATCGACGATGATGGTTGGGGATGGG
GCGGTGGATGCGCCTGTGATGGCGAAATCGGGACAGGGGTTTGGGTTGTTGAGGAGAGAGACTTCGGGATTTTCG
ATTGCGAGTATTATTTCGAGGACGAGGGTGCAGCAGCAGGGAGAGGATGGACAACAGTTGGTGGATGTTGGGTCT
TCTAGACCTGGGAGTCTTAGATCGTTCAGGGATGAGGGAAGTGAAGACGAGGATGAGGATGAGGATGAGGATGAT
GAGGAGGATATGGAAGAGGAGGACGGGGAGGAGTATAGTGATGATGATAGCGATGATGATGAGGAGGGAGATGGT
GGCGAAGAAGATAATGCAGATATGAGGAGTGATTATAGTGCGCGAGAGTTTGGGGAAAGTGAAGATGAAGAAAAT
CGAACACAAACAGGAATCAATATACCTGGAATTCAAATTACATCGAAATCGTCGTCACCCTACATGTCAAAAGGT
CCAAGTCAGAGTGCAAGTTCATTTGGGACGGATACTAGGAGTATAAGGAGTTTTGAGAGTATGATGAGTGAGGGT
AAGAAACGACAACAGCAGAAGAAGATGAAGATGAAAAAGAAGATTAAGCAAAAGGTGAAGAAGGCGAATGAGAGG
GAGAGGAAGGAGAGGGAGAAGGTGGAGAAGGGGAATAGTGGTGGTAAGGATGTTAGGTTGGGTCGTGAACCAAGG
AAGAGTATTTCAGATAGATTGGCTAGTGTTAGTGCGTTGGTTGGTGGACTCAACAAGACGTCTTCGCCACCTCCG
GAATCTCGTCATTCCTCTTTTCTTCAACCACCAACAAACATCGTTGCGCCTATACCAGTACATGCAAGACTCAGC
ATATCCCCTTCGTCATCTCGAGCACCATCACCTTCAGCGACATCGAGATCACCATCACCTCTTGCAAAAACGTTG
CCAGGGACCAACATGACCACTGCGCCCATGACACGAGTTAGAGAACCGTCTGCGGAGTTTCCTTTACCCCTACCA
GTACCGCGATCATCAACTTTACCTATCCCTAGCACTACTACGTCTCAATCTCAGAATATGCAAGCACGAGTTTTA
CCACAACCGAATCGAAGATTTATGGAATGTGCGAGTGTTGAGGAGTTGAGGATTGGAGAAGTTGGAGAGTTGTTG
GAGGAATATAGGAAGTTGGTGGAGGGCGTTAGAAGTTTGGGTTTGATTTGA
Transcript >Agabi119p4|096290
ATGGACGGCCATCCTCAGTTCCCAGCCACTTCCTTGTCCAGGTCTACCGGCCATCGCCTGCAGGCTTCTACCACG
CAGGAACTTCATCCGCTTAGCTCTAGCCCTCCTGTAACCGATATTGCGGGGTTCAACAGCGCGCAGAAATACAAG
CCTTATACCCCAAGAACCCGTGTAGTCCCAGCTACAACCACCAACACTCTTGTGCATCCTCCATCTCCTTCACCT
GTCGCTGGCGAAGATGCCACTTCTAAGCTCCAACTTACGAAAGCCAAGTCTGAGGCTCAGAACCTCGGACTAGAC
ACGTCTAGTATCGGATGGGCCATCCTTGAAAAAGTCGTCGCTGAGAGCGAAACGGGAGAACTGTGGGCAGATGTT
TGGTCATCGGTTGCGAGTGGGCAGGCAACCATCTTGTTACCTGCAGAACCTCTGTCGACGCATGATAAACTTACT
CCCGAGTTTTTGAAAGATCATATCGCCTATTGTGATACATCGTCTAATGATCAGGCCCGGAAATCAGCACCTATC
GTCACCCTCTCAGGCCTTCGCGGAACCATACATGGAAACCGCTTAATATTCTCCACAACGCTTCATCCTTTATCG
ACGGCTTTCCAATCTCTTCGAGATCCAGTCACACGATCCTCATCTCTTAACAAGCTACCTTCTCTACCATCAATC
ACTACGTCTTTAGAGACTTCAACATACCCTGAGTTTAGGGTATTGAATGGTCCCACGACATTACCACTCCCACCT
CGAGCTCCTGCACCTCCGAAACCCCCTCTTCCTCCAAGACCGGGCGCAAGACCACTTGCTAATACTGCAGGTTCC
TCTACGCCATCCGCACCAACTTCGTCATCACGCATTCCTAATCCTTTCGCCTCTCTCTTCGGTGGTGGAGGACAT
CGTCATTCCACTTCCACTTCTTCAACAACATCAGGAGTATTTGGTTCTCCTACACCATCAATACGAAGTAATGAT
TTACTTCCGATAACGCCTGCAGCAGATCCCGTATCTCAAACCGTCGAAGTCAGCGCTATCATCATTGATAAAAAG
TTGGATAGGAAGGTCATAGGGAAGATGATGAATGAGGCTTTATCAAAAGAAATCAAAGCTATGTTGAATGGTCAA
GATGTTCCGAGATGGGTTGCTTTGAGGGTAACTGAATTTTGTCAACCTTGGTTTCCATTCATTCGCGCCCCCAAA
ATCATTTCTGCCTCCCTCTCTAAATCTACAACAAAACAAGTAAAAGAGGATAAAGAGAAAGATGCGACGGTGTTG
CCGGAATGGAATGTTAATCCGGATAGGACGGATGGAGAGGCGTCGATTGAAGATAAAATGGATTTTGTGCAGGAG
TTTTATATGCAACTTGAAGAAGGTTTGAGAGTTGATTTGGGATTGAATAATGAAGGGCATTTTGATCAGAATGGA
GATGTGGAAAAGGAAATGATGGAGAAGATGGAATTGTCTGCGACGAGGGTTAGAAATATAATGGAACTCGTTGAA
CGGACGATATGTTCGTTATTCTATGACCGGTTATTTATGCAACCTCAATCCGACGACTCGCAACATGATACGGCA
CTTTCGAATCGCGTAGCAGCTCTAAATCTCCTTGATCTCACTCTCGAACACCTCGATATCGAAATCAGTGAAACG
AGTACTATACCGAAAATCAATAATATCGTTCGTGCTTGTGGTCAAAGATTGAGTGATTTGGAGGATGTGAGGGCA
CCGAAGGATAAAGCTAGAATTTTGGTTGATGCTCATCAGATTGTCGTTGATGGGTTATCGAAATTGCCGCCTATA
AGACTTATGTCAGCTGAAGAATCGAAAGCTCTTCGAGAACGATTACAGCAACAACAAGCTACGGCAGCGGCAGCG
GCAGCCAATGCTAATCCTAATACTGTCACACCACCACCTGTTGGACCTCAAGTTTTATTGACGACGAGTTCTCCT
GAAAGATATGCTATGGCGGCTACTCCGACTAGTACGACCACGCCTATGACTACTACTACTACTACTGCGACTGTG
GAATCTACCACTACTGCGCTTCTGGCAACTGAGGAAGGTGGGACGGCTTCGCCGAGAACTGGAAGTGCGGAAATG
ACCCATGGGGCGGAACTTTCGCCGTTGTCGTTTTCGACGAAGGAGACTTTGTCTTCGGAATCGCCTTCTCGGTCT
TCATCACCTACGATAGATAAAGACGATGAATCTCAGAAGAAGAAGATGAAGAAGAAACCGACACCCGTTTCTTCG
GATATTCTCTTACCCATGATCATATTCTCAGTCGTCAAATCTAATCCTCCTCACCTCGTTTCGAGTTTACTTTAT
ACTCAACGATTTCGGAATCAGAGTGCGTTTATGCAAGAGGGGAATGGGGGAGAGAGTTTTTGTTTGATTAATTTG
GTGGCTGTTGCTGAGTTTTTGGAAAATGTGGATTTGGAGGGACTTGGGTTAGGGTCGGCGGCTGATACCAGTGCG
ACGGAGTTGTCACCGATTATAACGAGACCTCCTACACCATTTGCTCCTTCTGTACCAACGACACCGAAAAGTATC
GCTTCGGGTATAGATCTGAGAGGGAAAGTTGAACAACGAGTGGATGCTATTGCTGGATCGGCGAATAAAGTGTTT
TCGGGGGTGGTGGATTCTTCCTTTGGGATTTTGAAGTCTTTGTTACCGCATCAACAGCAGGAAGGAGGAGTTTTC
GATTCTATGACAACTACAACTACTACTATTACTACTGGGCCAGATGGTAAATCGACGATGATGGTTGGGGATGGG
GCGGTGGATGCGCCTGTGATGGCGAAATCGGGACAGGGGTTTGGGTTGTTGAGGAGAGAGACTTCGGGATTTTCG
ATTGCGAGTATTATTTCGAGGACGAGGGTGCAGCAGCAGGGAGAGGATGGACAACAGTTGGTGGATGTTGGGTCT
TCTAGACCTGGGAGTCTTAGATCGTTCAGGGATGAGGGAAGTGAAGACGAGGATGAGGATGAGGATGAGGATGAT
GAGGAGGATATGGAAGAGGAGGACGGGGAGGAGTATAGTGATGATGATAGCGATGATGATGAGGAGGGAGATGGT
GGCGAAGAAGATAATGCAGATATGAGGAGTGATTATAGTGCGCGAGAGTTTGGGGAAAGTGAAGATGAAGAAAAT
CGAACACAAACAGGAATCAATATACCTGGAATTCAAATTACATCGAAATCGTCGTCACCCTACATGTCAAAAGGT
CCAAGTCAGAGTGCAAGTTCATTTGGGACGGATACTAGGAGTATAAGGAGTTTTGAGAGTATGATGAGTGAGGGT
AAGAAACGACAACAGCAGAAGAAGATGAAGATGAAAAAGAAGATTAAGCAAAAGGTGAAGAAGGCGAATGAGAGG
GAGAGGAAGGAGAGGGAGAAGGTGGAGAAGGGGAATAGTGGTGGTAAGGATGTTAGGTTGGGTCGTGAACCAAGG
AAGAGTATTTCAGATAGATTGGCTAGTGTTAGTGCGTTGGTTGGTGGACTCAACAAGACGTCTTCGCCACCTCCG
GAATCTCGTCATTCCTCTTTTCTTCAACCACCAACAAACATCGTTGCGCCTATACCAGTACATGCAAGACTCAGC
ATATCCCCTTCGTCATCTCGAGCACCATCACCTTCAGCGACATCGAGATCACCATCACCTCTTGCAAAAACGTTG
CCAGGGACCAACATGACCACTGCGCCCATGACACGAGTTAGAGAACCGTCTGCGGAGTTTCCTTTACCCCTACCA
GTACCGCGATCATCAACTTTACCTATCCCTAGCACTACTACGTCTCAATCTCAGAATATGCAAGCACGAGTTTTA
CCACAACCGAATCGAAGATTTATGGAATGTGCGAGTGTTGAGGAGTTGAGGATTGGAGAAGTTGGAGAGTTGTTG
GAGGAATATAGGAAGTTGGTGGAGGGCGTTAGAAGTTTGGGTTTGATTTGA
Gene >Agabi119p4|096290
ATGGACGGCCATCCTCAGTTCCCAGCCACTTCCTTGTCCAGGTCTACCGGCCATCGCCTGCAGGCTTCTACCACG
CAGGAACTTCATCCGCTTAGCTCTAGCCCTCCTGTAACCGATATTGCGGGGTTCAACAGCGCGCAGAAATACAAG
CCTTATACCCCAAGAACCCGTGTAGTCCCAGCTACAACCACCAACACTCTTGTGCATCCTCCATCTCCTTCACCT
GTCGCTGGCGAAGATGCCACTTCTAAGCTCCAACTTACGAAAGCCAAGTCTGAGGCTCAGAACCTCGGACTAGAC
ACGTCTAGTATCGGATGGGCCATCCTTGAAAAAGTCGTCGCTGAGAGCGAAACGGGAGAACTGTGGGCAGATGTT
TGGTCATCGGTTGCGAGTGGGCAGGTCTGTACATCGTCTGACTCTGCTGTGGAAGACGAGCCTAATAAATTTATC
AGGCAACCATCTTGTTACCTGCAGAACCTCTGTCGACGCATGATAAACTTACTCCCGAGTTTTTGAAAGATCATA
TCGCCTATTGTGATACATCGTCTAATGATCAGGCCCGGAAATCAGCACCTATCGTCACCCTCTCAGGCCTTCGCG
GAACCATACATGGGTATGTCGCGTAATGCCCTCCCCGAGATTAACCTTCTTACACAAGGCAAGAATAGAAACCGC
TTAATATTCTCCACAACGCTTCATCCTTTATCGACGGCTTTCCAATCTCTTCGAGATCCAGTCACACGATCCTCA
TCTCTTAACAAGCTACCTTCTCTACCATCAATCACTACGTCTTTAGAGACTTCAACATACCCTGAGTTTAGGGTA
TTGAATGGTCCCACGACATTACCACTCCCACCTCGAGCTCCTGCACCTCCGAAACCCCCTCTTCCTCCAAGACCG
GGCGCAAGACCACTTGCTAATACTGCAGGTTCCTCTACGCCATCCGCACCAACTTCGTCATCACGCATTCCTAAT
CCTTTCGCCTCTCTCTTCGGTGGTGGAGGACATCGTCATTCCACTTCCACTTCTTCAACAACATCAGGAGTATTT
GGTTCTCCTACACCATCAATACGAAGTAATGATTTACTTCCGATAACGCCTGCAGCAGATCCCGTATCTCAAACC
GTCGAAGTCAGCGCTATCATCATTGATAAAAAGTTGGATAGGAAGGTCATAGGGAAGATGATGAATGAGGCTTTA
TCAAAAGAAATCAAAGCTATGTTGAATGGTCAAGATGTTCCGAGATGGGTTGCTTTGAGGGTAACTGAATTTTGT
CAACCTTGGTTTCCATTCATTCGCGCCCCCAAAATCATTTCTGCCTCCCTCTCTAAATCTACAACAAAACAAGTA
AAAGAGGATAAAGAGAAAGATGCGACGGTGTTGCCGGAATGGAATGTTAATCCGGATAGGACGGATGGAGAGGCG
TCGATTGAAGATAAAATGGATTTTGTGCAGGAGTTTTATATGCAACTTGAAGAAGGTTTGAGAGTTGATTTGGGA
TTGAATAATGAAGGGCATTTTGATCAGAATGGAGATGTGGAAAAGGAAATGATGGAGAAGATGGAATTGTCTGCG
ACGAGGGTTAGAAATATAATGGAACTCGTTGAACGGACGATATGTTCGTTATTCTATGACCGGTGCGTTATCAAA
CGAATGGCATTCAACCTTAATTCGCTAAATACTTTGAAAAAGGTTATTTATGCAACCTCAATCCGACGACTCGCA
ACATGATACGGCACTTTCGAATCGCGTAGCAGCTCTAAATCTCCTTGATCTCACTCTCGAACACCTCGATATCGA
AATCAGTGAAACGAGTACTATACCGAAAATCAATAATATCGTTCGTGCTTGTGGTCAAAGTCAGTACATTTCAAA
TATTATAATGAGGATGAATGTTGATTTTTTTGATATTTTTTTTTTGGTCTAGGATTGAGTGATTTGGAGGATGTG
AGGGCACCGAAGGATAAAGCTAGAATTTTGGTTGATGCTCATCAGATTGTCGTTGGTATGTTTATCTTATTTATT
TTCGTGCATGAAAATAAGAAACTTTGGTAGATGGGTTATCGAAATTGCCGCCTATAAGACTTATGTCAGCTGAAG
AATCGAAAGCTCTTCGAGAACGATTACAGCAACAACAAGCTACGGCAGCGGCAGCGGCAGCCAATGCTAATCCTA
ATACTGTCACACCACCACCTGTTGGACCTCAAGTTTTATTGACGACGAGTTCTCCTGAAAGATATGCTATGGCGG
CTACTCCGACTAGTACGACCACGCCTATGACTACTACTACTACTACTGCGACTGTGGAATCTACCACTACTGCGC
TTCTGGCAACTGAGGAAGGTGGGACGGCTTCGCCGAGAACTGGAAGTGCGGAAATGACCCATGGGGCGGAACTTT
CGCCGTTGTCGTTTTCGACGAAGGAGACTTTGTCTTCGGAATCGCCTTCTCGGTCTTCATCACCTACGATAGATA
AAGACGATGAATCTCAGAAGAAGAAGATGAAGAAGAAACCGACACCCGTTTCTTCGGATATTCTCTTACCCATGA
TCATATTCTCAGTCGTCAAATCTAATCCTCCTCACCTCGTTTCGAGTTTACTTTATACTCAACGATTTCGGAATC
AGAGTGCGTTTATGCAAGAGGGGAATGGGGGAGAGAGTTTTTGTTTGATTAATTTGGTGGCTGTTGCTGAGTTTT
TGGAAAATGTGGATTTGGAGGGACTTGGGTTAGGGTCGGCGGCTGATACCAGGTGAGTTTTTTTTTTGTTTTATT
ACAATGTTGGACTGAGTTGACGAAATTAATGAAAGTGCGACGGAGTTGTCACCGATTATAACGAGACCTCCTACA
CCATTTGCTCCTTCTGTACCAACGACACCGAAAAGTATCGCTTCGGGTATAGATCTGAGAGGGAAAGTTGAACAA
CGAGTGGATGCTATTGCTGGATCGGCGAATAAAGTGTTTTCGGGGGTGGTGGATTCTTCCTTTGGGATTTTGAAG
TCTTTGTTACCGCATCAACAGCAGGAAGGAGGAGTTTTCGATTCTATGACAACTACAACTACTACTATTACTACT
GGGCCAGATGGTAAATCGACGATGATGGTTGGGGATGGGGCGGTGGATGCGCCTGTGATGGCGAAATCGGGACAG
GGGTTTGGGTTGTTGAGGAGAGAGACTTCGGGATTTTCGATTGCGAGTATTATTTCGAGGACGAGGGTGCAGCAG
CAGGGAGAGGATGGACAACAGTTGGTGGATGTTGGGTCTTCTAGACCTGGGAGTCTTAGATCGTTCAGGGATGAG
GGAAGTGAAGACGAGGATGAGGATGAGGATGAGGATGATGAGGAGGATATGGAAGAGGAGGACGGGGAGGAGTAT
AGTGATGATGATAGCGATGATGATGAGGAGGGAGATGGTGGCGAAGAAGATAATGCAGATATGAGGAGTGATTAT
AGTGCGCGAGAGTTTGGGGAAAGTGAAGATGAAGAAAATCGAACACAAACAGGAATCAATATACCTGGAATTCAA
ATTACATCGAAATCGTCGTCACCCTACATGTCAAAAGGTCCAAGTCAGAGTGCAAGTTCATTTGGGACGGATACT
AGGAGTATAAGGAGTTTTGAGAGTATGATGAGTGAGGGTAAGAAACGACAACAGCAGAAGAAGATGAAGATGAAA
AAGAAGATTAAGCAAAAGGTGAAGAAGGCGAATGAGAGGGAGAGGAAGGAGAGGGAGAAGGTGGAGAAGGGGAAT
AGTGGTGGTAAGGATGTTAGGTTGGGTCGTGAACCAAGGAAGAGTATTTCAGATAGATTGGCTAGTGTTAGTGCG
TTGGTTGGTGGACTCAACAAGGTAAAGCTTAAATTTCTTCCCCTTTATTTAATATTTATCATAGCGATTTAGACG
TCTTCGCCACCTCCGGAATCTCGTCATTCCTCTTTTCTTCAACCACCAACAAACATCGTTGCGCCTATACCAGTA
CATGCAAGACTCAGCATATCCCCTTCGTCATCTCGAGCACCATCACCTTCAGCGACATCGAGATCACCATCACCT
CTTGCAAAAACGTTGCCAGGGACCAACATGACCACTGCGCCCATGACACGAGTTAGAGAACCGTCTGCGGAGTTT
CCTTTACCCCTACCAGTACCGCGATCATCAACTTTACCTATCCCTAGCACTACTACGTCTCAATCTCAGAATATG
CAAGCACGAGTTTTACCACAACCGAATCGAAGATTTATGGAATGTGCGAGTGTTGAGGAGTTGAGGATTGGAGAA
GTTGGAGAGTTGTTGGAGGAATATAGGAAGTTGGTGGAGGGCGTTAGAAGTTTGGGTTTGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail