Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|095990
Gene name
Locationscaffold_06:2053428..2054680
Strand+
Gene length (bp)1252
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01885 PTS_2-RNA RNA 2'-phosphotransferase, Tpt1 / KptA family 2.9E-64 126 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5EAR5|TRPT1_DANRE tRNA 2'-phosphotransferase 1 OS=Danio rerio GN=trpt1 PE=2 SV=2 126 334 1.0E-43
sp|O14045|TPT1_SCHPO Putative tRNA 2'-phosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.12c PE=3 SV=2 127 334 2.0E-40
sp|Q3ZBM7|TRPT1_BOVIN tRNA 2'-phosphotransferase 1 OS=Bos taurus GN=TRPT1 PE=2 SV=3 126 342 2.0E-36
sp|Q8K3A2|TRPT1_MOUSE tRNA 2'-phosphotransferase 1 OS=Mus musculus GN=Trpt1 PE=2 SV=2 104 342 3.0E-36
sp|Q86TN4|TRPT1_HUMAN tRNA 2'-phosphotransferase 1 OS=Homo sapiens GN=TRPT1 PE=1 SV=2 115 342 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5EAR5|TRPT1_DANRE tRNA 2'-phosphotransferase 1 OS=Danio rerio GN=trpt1 PE=2 SV=2 126 334 1.0E-43
sp|O14045|TPT1_SCHPO Putative tRNA 2'-phosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.12c PE=3 SV=2 127 334 2.0E-40
sp|Q3ZBM7|TRPT1_BOVIN tRNA 2'-phosphotransferase 1 OS=Bos taurus GN=TRPT1 PE=2 SV=3 126 342 2.0E-36
sp|Q8K3A2|TRPT1_MOUSE tRNA 2'-phosphotransferase 1 OS=Mus musculus GN=Trpt1 PE=2 SV=2 104 342 3.0E-36
sp|Q86TN4|TRPT1_HUMAN tRNA 2'-phosphotransferase 1 OS=Homo sapiens GN=TRPT1 PE=1 SV=2 115 342 3.0E-35
sp|Q12272|TPT1_YEAST tRNA 2'-phosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPT1 PE=1 SV=1 121 333 2.0E-23
sp|Q1MG28|KPTA_RHIL3 Probable RNA 2'-phosphotransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=kptA PE=3 SV=1 126 325 3.0E-22
sp|B5ZQT5|KPTA_RHILW Probable RNA 2'-phosphotransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=kptA PE=3 SV=1 126 325 2.0E-21
sp|B2IZ22|KPTA_NOSP7 Probable RNA 2'-phosphotransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=kptA PE=3 SV=1 127 326 8.0E-21
sp|B9JFP7|KPTA_AGRRK Probable RNA 2'-phosphotransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=kptA PE=3 SV=1 126 325 2.0E-20
sp|Q8XP22|KPTA_CLOPE Probable RNA 2'-phosphotransferase OS=Clostridium perfringens (strain 13 / Type A) GN=kptA PE=3 SV=1 128 333 6.0E-19
sp|Q0TUT1|KPTA_CLOP1 Probable RNA 2'-phosphotransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kptA PE=3 SV=1 128 326 4.0E-18
sp|Q0SWM0|KPTA_CLOPS Probable RNA 2'-phosphotransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=kptA PE=3 SV=1 128 326 4.0E-17
sp|Q3M450|KPTA_ANAVT Probable RNA 2'-phosphotransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=kptA PE=3 SV=1 126 327 4.0E-16
sp|Q48DQ3|KPTA_PSE14 Probable RNA 2'-phosphotransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=kptA PE=3 SV=1 128 317 5.0E-16
sp|Q8R5N7|KPTA_FUSNN Probable RNA 2'-phosphotransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=kptA PE=3 SV=1 126 327 6.0E-16
sp|Q87VZ5|KPTA_PSESM Probable RNA 2'-phosphotransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=kptA PE=3 SV=1 128 335 1.0E-15
sp|A9B356|KPTA_HERA2 Probable RNA 2'-phosphotransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=kptA PE=3 SV=1 127 328 1.0E-15
sp|Q7UEP2|KPTA_RHOBA Probable RNA 2'-phosphotransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=kptA PE=3 SV=1 127 327 2.0E-15
sp|A5FLZ4|KPTA_FLAJ1 Probable RNA 2'-phosphotransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=kptA PE=3 SV=1 129 318 7.0E-15
sp|Q63WX9|KPTA_BURPS Probable RNA 2'-phosphotransferase OS=Burkholderia pseudomallei (strain K96243) GN=kptA PE=3 SV=1 128 327 9.0E-15
sp|Q7NVB8|KPTA_CHRVO Probable RNA 2'-phosphotransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=kptA PE=3 SV=2 115 319 3.0E-14
sp|Q6HH75|KPTA_BACHK Probable RNA 2'-phosphotransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kptA PE=3 SV=1 129 318 5.0E-14
sp|Q4K4C7|KPTA_PSEF5 Probable RNA 2'-phosphotransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=kptA PE=3 SV=1 130 326 2.0E-13
sp|B1VP90|KPTA_STRGG Probable RNA 2'-phosphotransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=kptA PE=3 SV=1 127 319 2.0E-13
sp|Q8U9Z2|KPTA_AGRFC Probable RNA 2'-phosphotransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kptA PE=3 SV=1 130 337 4.0E-13
sp|A3DJX6|KPTA_CLOTH Probable RNA 2'-phosphotransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=kptA PE=3 SV=1 128 328 4.0E-13
sp|B0C090|KPTA_ACAM1 Probable RNA 2'-phosphotransferase OS=Acaryochloris marina (strain MBIC 11017) GN=kptA PE=3 SV=1 129 318 1.0E-12
sp|Q395F2|KPTA_BURL3 Probable RNA 2'-phosphotransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=kptA PE=3 SV=1 127 326 8.0E-12
sp|Q9ZBX9|KPTA_STRCO Probable RNA 2'-phosphotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kptA PE=3 SV=1 127 327 1.0E-11
sp|Q0T8X6|KPTA_ECOL5 Probable RNA 2'-phosphotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kptA PE=3 SV=1 121 317 8.0E-11
sp|Q6DA62|KPTA_PECAS Probable RNA 2'-phosphotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=kptA PE=3 SV=1 129 326 2.0E-10
sp|B7MMM2|KPTA_ECO45 Probable RNA 2'-phosphotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kptA PE=3 SV=1 121 330 3.0E-10
sp|B1LDT4|KPTA_ECOSM Probable RNA 2'-phosphotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kptA PE=3 SV=1 121 330 5.0E-10
sp|B2TYV0|KPTA_SHIB3 Probable RNA 2'-phosphotransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kptA PE=3 SV=1 121 317 7.0E-10
sp|B7LXP0|KPTA_ECO8A Probable RNA 2'-phosphotransferase OS=Escherichia coli O8 (strain IAI1) GN=kptA PE=3 SV=1 121 317 9.0E-10
sp|A8A858|KPTA_ECOHS Probable RNA 2'-phosphotransferase OS=Escherichia coli O9:H4 (strain HS) GN=kptA PE=3 SV=1 121 317 1.0E-09
sp|B6I2L3|KPTA_ECOSE Probable RNA 2'-phosphotransferase OS=Escherichia coli (strain SE11) GN=kptA PE=3 SV=1 121 317 1.0E-09
sp|B7LDY6|KPTA_ECO55 Probable RNA 2'-phosphotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=kptA PE=3 SV=1 121 317 1.0E-09
sp|O29841|KPTA1_ARCFU Probable RNA 2'-phosphotransferase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=kptA1 PE=3 SV=1 128 330 2.0E-09
sp|A7ZVN0|KPTA_ECO24 Probable RNA 2'-phosphotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kptA PE=3 SV=1 121 317 2.0E-09
sp|P39380|KPTA_ECOLI RNA 2'-phosphotransferase OS=Escherichia coli (strain K12) GN=kptA PE=3 SV=2 121 317 2.0E-09
sp|B7NGY8|KPTA_ECOLU Probable RNA 2'-phosphotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kptA PE=3 SV=1 121 317 2.0E-09
sp|C4ZT19|KPTA_ECOBW Probable RNA 2'-phosphotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kptA PE=3 SV=1 121 317 2.0E-09
sp|Q037J6|KPTA_LACC3 Probable RNA 2'-phosphotransferase OS=Lactobacillus casei (strain ATCC 334) GN=kptA PE=3 SV=1 127 317 2.0E-09
sp|C6DJM6|KPTA_PECCP Probable RNA 2'-phosphotransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=kptA PE=3 SV=1 129 317 6.0E-09
sp|Q8U4K2|KPTA_PYRFU Probable RNA 2'-phosphotransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=kptA PE=3 SV=2 128 295 1.0E-08
sp|Q5JFX3|KPTA_THEKO Probable RNA 2'-phosphotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=kptA PE=3 SV=1 128 318 3.0E-08
sp|O28719|KPTA2_ARCFU Probable RNA 2'-phosphotransferase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=kptA2 PE=3 SV=1 128 306 3.0E-08
sp|Q2SQM5|KPTA_HAHCH Probable RNA 2'-phosphotransferase OS=Hahella chejuensis (strain KCTC 2396) GN=kptA PE=3 SV=1 136 327 5.0E-08
sp|O57899|KPTA_PYRHO Probable RNA 2'-phosphotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=kptA PE=3 SV=1 128 295 9.0E-08
sp|B6YXF3|KPTA_THEON Probable RNA 2'-phosphotransferase OS=Thermococcus onnurineus (strain NA1) GN=kptA PE=3 SV=1 128 318 1.0E-07
sp|Q9YFP5|KPTA_AERPE Probable RNA 2'-phosphotransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=kptA PE=1 SV=2 127 318 2.0E-06
sp|Q02V26|KPTA_PSEAB Probable RNA 2'-phosphotransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=kptA PE=3 SV=1 130 318 5.0E-06
sp|Q9I778|KPTA_PSEAE Probable RNA 2'-phosphotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kptA PE=3 SV=1 130 318 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016740 transferase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|095990
MALLHRLPRDSRLPVAFLIHLSSANTRPSPSAFSRGHSIPLLSLLQARTAAGYAGAKKPNNIWKQAPPSKGPSQS
SSQNDSNDHRHRKQKTEMSKKSQRSKQEGVNHRDGNGSHPKLRGTERDLPEVKLSKTLSWILRHGGAYEGLAMRE
DGFVYVSDILKHSRLRTFGLTLERLKGIVQTDPKQRFSLVFERSDATRLNYTVVEGNEDENGMWLIKANQGHSIS
AVKIELESILQVSDIPSGLAVHGTTRSAWNVIEKEGLSKMNRNHIHMAQGVGKDDVISGMRQSSQILIFINVQKA
LDAGIKFYLSDNGVVLTDGDEHGYLKMEFIDRVEDARTRKAIEGWEGSGETVG*
Coding >Agabi119p4|095990
ATGGCACTACTTCATCGTTTGCCACGCGACTCTCGTCTTCCCGTTGCTTTTTTGATTCATCTAAGTTCTGCGAAT
ACTCGACCTTCTCCGTCAGCCTTTTCTCGTGGACACTCGATTCCCTTGTTGTCCTTACTTCAGGCTCGAACTGCC
GCAGGTTACGCGGGTGCAAAAAAACCGAATAACATTTGGAAACAAGCCCCTCCTTCTAAAGGACCTTCTCAAAGT
TCATCACAAAATGATTCAAATGATCATAGACATCGAAAACAGAAGACTGAAATGTCCAAAAAATCTCAGAGGTCG
AAGCAAGAAGGCGTCAACCATCGAGATGGGAATGGGTCTCACCCTAAACTTCGTGGTACAGAAAGAGATTTACCC
GAAGTGAAATTGTCGAAAACTTTATCTTGGATACTACGACATGGAGGTGCATATGAAGGTTTAGCGATGCGGGAA
GATGGGTTCGTGTATGTCAGCGACATCCTGAAACATAGTCGCCTACGGACATTTGGTTTGACTTTGGAGAGACTA
AAAGGCATTGTCCAAACCGATCCTAAACAACGATTTTCGCTGGTTTTCGAACGGTCGGACGCAACTCGACTCAAT
TATACCGTTGTTGAGGGAAATGAAGATGAGAATGGTATGTGGCTCATTAAGGCGAACCAAGGGCACTCGATTAGT
GCTGTCAAAATTGAACTTGAATCTATCCTTCAGGTTTCAGATATACCTTCCGGATTGGCAGTGCACGGGACAACT
CGCTCTGCTTGGAATGTCATAGAAAAGGAAGGTCTGTCAAAGATGAATAGAAATCACATACACATGGCACAAGGT
GTTGGTAAGGACGATGTTATCAGCGGCATGAGACAATCATCCCAGATACTCATTTTTATCAACGTCCAAAAGGCG
TTAGATGCTGGGATAAAGTTCTATTTGTCCGATAATGGGGTAGTACTCACGGATGGTGACGAACATGGATACTTG
AAGATGGAGTTTATCGATAGAGTAGAGGACGCGAGAACAAGGAAAGCGATCGAGGGATGGGAGGGGAGTGGGGAG
ACTGTTGGATAA
Transcript >Agabi119p4|095990
ATGGCACTACTTCATCGTTTGCCACGCGACTCTCGTCTTCCCGTTGCTTTTTTGATTCATCTAAGTTCTGCGAAT
ACTCGACCTTCTCCGTCAGCCTTTTCTCGTGGACACTCGATTCCCTTGTTGTCCTTACTTCAGGCTCGAACTGCC
GCAGGTTACGCGGGTGCAAAAAAACCGAATAACATTTGGAAACAAGCCCCTCCTTCTAAAGGACCTTCTCAAAGT
TCATCACAAAATGATTCAAATGATCATAGACATCGAAAACAGAAGACTGAAATGTCCAAAAAATCTCAGAGGTCG
AAGCAAGAAGGCGTCAACCATCGAGATGGGAATGGGTCTCACCCTAAACTTCGTGGTACAGAAAGAGATTTACCC
GAAGTGAAATTGTCGAAAACTTTATCTTGGATACTACGACATGGAGGTGCATATGAAGGTTTAGCGATGCGGGAA
GATGGGTTCGTGTATGTCAGCGACATCCTGAAACATAGTCGCCTACGGACATTTGGTTTGACTTTGGAGAGACTA
AAAGGCATTGTCCAAACCGATCCTAAACAACGATTTTCGCTGGTTTTCGAACGGTCGGACGCAACTCGACTCAAT
TATACCGTTGTTGAGGGAAATGAAGATGAGAATGGTATGTGGCTCATTAAGGCGAACCAAGGGCACTCGATTAGT
GCTGTCAAAATTGAACTTGAATCTATCCTTCAGGTTTCAGATATACCTTCCGGATTGGCAGTGCACGGGACAACT
CGCTCTGCTTGGAATGTCATAGAAAAGGAAGGTCTGTCAAAGATGAATAGAAATCACATACACATGGCACAAGGT
GTTGGTAAGGACGATGTTATCAGCGGCATGAGACAATCATCCCAGATACTCATTTTTATCAACGTCCAAAAGGCG
TTAGATGCTGGGATAAAGTTCTATTTGTCCGATAATGGGGTAGTACTCACGGATGGTGACGAACATGGATACTTG
AAGATGGAGTTTATCGATAGAGTAGAGGACGCGAGAACAAGGAAAGCGATCGAGGGATGGGAGGGGAGTGGGGAG
ACTGTTGGATAA
Gene >Agabi119p4|095990
ATGGCACTACTTCATCGTTTGCCACGCGACTCTCGTCTTCCCGTTGCTTTTTTGATTCATCTAAGTTCTGCGAAT
ACTCGACCTTCTCCGTCAGCCTTTTCTCGTGGACACTCGATTCCCTTGTTGTCCTTACTTCAGGCTCGAACTGCC
GCAGGTTACGCGGGTGCAAAAAAACCGAATAACATTTGGAAACAAGCCCCTCCTTCTAAAGGACCTTCTCAAAGT
TCATCACAAAATGATTCAAATGATCATAGACATCGAAAACAGAAGACTGAAATGTCCAAAAAATCTCAGAGGTCG
AAGCAAGAAGGCGTCAACCATCGAGATGGGAATGGGTCTCACCCTAAACTTCGTGGTACAGAAAGAGATTTACCC
GAAGTGAAATTGTCGAAAACTTTATCTTGGATACTACGACATGGAGGTGCATATGAAGGTTTAGCGATGCGGGAA
GATGGGTTCGTGTATGTCAGCGACATCGTGCGTGTATCTCTCCCAACACCTCTCACTATTCACGCTCTGTATACT
AATATGACATATTTTTGAAGCTGAAACATAGTCGCCTACGGACATTTGGTTTGACTTTGGAGAGACTAAAAGGCA
TTGTCCAAACCGATCCTAAACAACGATTTTCGCTGGTTTTCGAACGGTCGGACGCAACTCGACTCAATTATACCG
TTGTTGAGGGAAATGAAGATGAGAATGGTATGTGGCTCATTAAGGCGAACCAAGGGCACTCGATTAGTGTACGTT
GCGACCGGATAATTAAGCTGCTGTCAGCCGCTAACTACATTTATACAGGCTGTCAAAATTGAACTTGAATCTATC
CTTCAGGTTTCAGATATACCTTCCGGATTGGCAGTGCACGGGACAACTCGCTCTGCTTGGAATGTCATAGAAAAG
GAAGGTCTGTCAAAGATGAATAGAAATCACATACACATGGCACAAGGTGTTGGTAAGGACGATGTTATCAGCGGT
ATGTGCCGTTTTTTCTGTACTTAAACCTCCGCGGCGCAATACCTTTCTAAATTTATTGACGACAGGCATGAGACA
ATCATCCCAGATACTCATTTTTATCAACGTCCAAAAGGCGTTAGATGCTGGGATAAAGTTCTATTTGTCCGATAA
TGGGGTAGTACTCACGGATGGTGACGAACATGGATACTTGAAGATGGAGTTTATCGATAGAGTAGAGGACGCGAG
AACAAGGAAAGCGATCGAGGGATGGGAGGGGAGTGGGGAGACTGTTGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail