Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|095750
Gene name
Locationscaffold_06:1964823..1967170
Strand-
Gene length (bp)2347
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 1.1E-13 543 576

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40209|GAT2_YEAST Protein GAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT2 PE=3 SV=1 512 578 2.0E-11
sp|Q54KX0|GTAN_DICDI GATA zinc finger domain-containing protein 14 OS=Dictyostelium discoideum GN=gtaN PE=3 SV=1 543 581 7.0E-11
sp|Q59LY1|BRG1_CANAL Biofilm regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRG1 PE=1 SV=1 543 579 1.0E-10
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 540 578 2.0E-10
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 496 579 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40209|GAT2_YEAST Protein GAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT2 PE=3 SV=1 512 578 2.0E-11
sp|Q54KX0|GTAN_DICDI GATA zinc finger domain-containing protein 14 OS=Dictyostelium discoideum GN=gtaN PE=3 SV=1 543 581 7.0E-11
sp|Q59LY1|BRG1_CANAL Biofilm regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRG1 PE=1 SV=1 543 579 1.0E-10
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 540 578 2.0E-10
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 496 579 2.0E-10
sp|B0G188|GTAP_DICDI GATA zinc finger domain-containing protein 16 OS=Dictyostelium discoideum GN=gtaP PE=3 SV=1 542 577 6.0E-10
sp|Q55C49|GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum GN=gtaG PE=3 SV=1 543 582 1.0E-09
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 543 583 1.0E-09
sp|Q5KSV0|GTAK_DICDI GATA zinc finger domain-containing protein 11 OS=Dictyostelium discoideum GN=gtaK PE=2 SV=1 543 578 2.0E-09
sp|P69781|GAT12_ARATH GATA transcription factor 12 OS=Arabidopsis thaliana GN=GATA12 PE=2 SV=1 479 572 3.0E-09
sp|Q54TM6|GTAI_DICDI GATA zinc finger domain-containing protein 9 OS=Dictyostelium discoideum GN=gtaI PE=3 SV=1 543 578 1.0E-08
sp|O82632|GATA9_ARATH GATA transcription factor 9 OS=Arabidopsis thaliana GN=GATA9 PE=2 SV=1 502 572 2.0E-08
sp|Q55GK0|GTAE_DICDI GATA zinc finger domain-containing protein 5 OS=Dictyostelium discoideum GN=gtaE PE=3 SV=1 543 581 2.0E-08
sp|Q9FJ10|GAT16_ARATH GATA transcription factor 16 OS=Arabidopsis thaliana GN=GATA16 PE=2 SV=1 530 601 2.0E-08
sp|Q54NM5|GTAL_DICDI GATA zinc finger domain-containing protein 12 OS=Dictyostelium discoideum GN=gtaL PE=3 SV=1 533 572 3.0E-08
sp|Q54HA4|GTAO_DICDI GATA zinc finger domain-containing protein 15 (Fragment) OS=Dictyostelium discoideum GN=gtaO PE=3 SV=1 542 582 5.0E-08
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 542 578 6.0E-08
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 496 573 7.0E-08
sp|Q55EQ0|GTAF_DICDI GATA zinc finger domain-containing protein 6 OS=Dictyostelium discoideum GN=gtaF PE=3 SV=1 543 583 2.0E-07
sp|Q9SV30|GATA8_ARATH GATA transcription factor 8 OS=Arabidopsis thaliana GN=GATA8 PE=2 SV=1 541 572 3.0E-07
sp|O65515|GATA7_ARATH GATA transcription factor 7 OS=Arabidopsis thaliana GN=GATA7 PE=2 SV=1 511 572 3.0E-07
sp|Q9FH57|GATA5_ARATH GATA transcription factor 5 OS=Arabidopsis thaliana GN=GATA5 PE=2 SV=1 507 572 4.0E-07
sp|Q9LIB5|GAT17_ARATH GATA transcription factor 17 OS=Arabidopsis thaliana GN=GATA17 PE=2 SV=1 541 591 9.0E-07
sp|Q9LT45|GAT29_ARATH GATA transcription factor 29 OS=Arabidopsis thaliana GN=GATA29 PE=2 SV=1 544 574 9.0E-07
sp|Q8LAU9|GATA1_ARATH GATA transcription factor 1 OS=Arabidopsis thaliana GN=GATA1 PE=2 SV=2 540 572 2.0E-06
sp|O49743|GATA4_ARATH GATA transcription factor 4 OS=Arabidopsis thaliana GN=GATA4 PE=2 SV=1 524 572 2.0E-06
sp|O49741|GATA2_ARATH GATA transcription factor 2 OS=Arabidopsis thaliana GN=GATA2 PE=2 SV=1 528 572 3.0E-06
sp|Q9ZPX0|GAT20_ARATH GATA transcription factor 20 OS=Arabidopsis thaliana GN=GATA20 PE=2 SV=2 543 574 3.0E-06
sp|Q6QPM2|GAT19_ARATH GATA transcription factor 19 OS=Arabidopsis thaliana GN=GATA19 PE=2 SV=2 543 599 6.0E-06
sp|Q8H1G0|GAT28_ARATH GATA transcription factor 28 OS=Arabidopsis thaliana GN=GATA28 PE=2 SV=1 545 573 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0031323 regulation of cellular metabolic process No
GO:0003676 nucleic acid binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003677 DNA binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0080090 regulation of primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|095750
MSSDGRYMYHHQPPSINNYDYGYPHHQQHQPQHHPPPPPPPHAYDNHPPPSHSQSQHPPHPHSHSQSHSQLGHPP
LRAPVPRSNSSSTHSHSPSQPNTSHPPPPPPHQSQHHSHHPPPPHQPPPSHQHQPPHSYYNPPPPHPPPGYPSNS
YIPPQAAPPPPTQHSHPQSHHPSHPNHPSHWGNESQWGGQFAYGAPPSSHPPASSGPPDYTPGPSRPTTGQENVA
NSTSAGPDHHRGSSGYMPPSQSAQPPQPPPTTIEPRRIDVRNDMSRMDNPRRDVRVDNRMNDRMDTRMDPPRMED
RIPPQHTSYHHPPPNVHHPQPSLQHPPPTPVSSAPTPIPISSSSTIAGATTAKNVRGRDSPASHPGPPRPSHPPA
HVLPPAGPLPPTHATMTSPPMSAIPPAAVSPGSLDFYKLLDQYRMILDNKEMISNNPNKVPSLDLLEKMIQCATL
ASHMFEEAAAGESTTSNYSSLMGANGVPAAASNNAREDTKESVLNGPTTNGSSATATGAPAPAPAPTSSGPPGKK
QKTDESNQGQGENHGQTCLGCGATSTPEWRRGPMGPRTLCNACGLVYAKMIKKRVREKYNQNGRSNGQTSQQNVV
DDSDDSDDDDDTNNYANDRGNN*
Coding >Agabi119p4|095750
ATGTCGTCCGACGGAAGGTATATGTATCACCACCAACCCCCGAGTATCAATAACTATGACTATGGCTATCCGCAT
CATCAACAACATCAGCCCCAACACCACCCTCCTCCGCCTCCGCCACCTCATGCCTACGATAATCACCCCCCTCCT
TCGCATTCTCAATCTCAACACCCACCTCACCCTCACTCTCATTCGCAGAGTCATTCGCAATTAGGCCACCCACCT
CTACGTGCTCCTGTTCCCCGTTCAAACTCGTCTTCGACTCATTCCCATTCTCCATCTCAACCAAATACATCTCAT
CCTCCCCCACCGCCTCCACATCAATCTCAACACCATTCGCACCATCCGCCTCCCCCGCATCAACCACCACCTTCA
CATCAACACCAGCCACCTCATTCGTATTATAATCCACCTCCACCTCATCCACCGCCTGGCTATCCCTCTAACTCT
TACATTCCGCCACAAGCTGCACCACCGCCCCCAACTCAGCACTCTCATCCTCAGTCTCACCACCCTAGTCACCCC
AATCACCCTAGTCATTGGGGAAATGAAAGTCAGTGGGGCGGTCAGTTTGCTTATGGCGCTCCTCCTTCATCACAC
CCTCCAGCATCTAGTGGCCCTCCAGATTATACCCCCGGTCCCAGTAGGCCGACGACTGGCCAGGAAAATGTGGCT
AACTCTACAAGCGCAGGACCAGATCACCATAGAGGGAGTTCGGGATACATGCCCCCTTCGCAGTCGGCGCAACCT
CCTCAGCCTCCACCTACCACGATTGAGCCCAGAAGGATCGATGTCAGGAATGATATGTCACGCATGGATAATCCA
AGAAGGGATGTGCGAGTGGATAACAGAATGAATGATCGAATGGATACAAGAATGGATCCTCCGAGAATGGAGGAT
CGAATACCCCCCCAGCACACATCGTATCATCATCCTCCACCTAATGTCCACCATCCTCAACCTTCATTACAGCAT
CCTCCACCGACGCCCGTTTCATCCGCGCCCACGCCAATACCTATTTCATCATCTTCAACAATTGCGGGTGCAACT
ACCGCTAAAAATGTTCGGGGAAGGGATTCGCCGGCTTCACATCCGGGACCTCCCCGTCCTTCTCATCCTCCTGCG
CATGTTCTACCTCCGGCGGGACCGCTGCCACCCACACATGCTACGATGACTAGCCCTCCCATGTCTGCTATTCCT
CCTGCTGCCGTTTCGCCTGGAAGCCTCGATTTTTACAAGCTTCTTGATCAATACCGCATGATTCTAGACAATAAG
GAAATGATCAGCAACAATCCAAACAAAGTTCCTTCTTTGGACTTATTGGAAAAGATGATTCAATGCGCGACCCTG
GCTTCGCATATGTTTGAGGAAGCTGCCGCCGGTGAAAGTACAACGTCGAATTATTCATCTCTCATGGGTGCGAAT
GGTGTCCCAGCCGCTGCATCGAACAACGCGAGAGAGGACACGAAAGAGTCTGTACTTAATGGACCTACGACAAAT
GGCTCTAGTGCGACCGCTACTGGTGCTCCCGCACCCGCACCCGCACCAACTTCATCAGGGCCCCCTGGTAAAAAA
CAGAAAACAGATGAAAGTAATCAGGGGCAAGGAGAAAACCACGGTCAGACGTGTTTGGGTTGTGGTGCCACTTCG
ACGCCCGAGTGGAGGCGTGGGCCCATGGGCCCCCGAACGTTGTGCAACGCGTGCGGGCTGGTTTATGCTAAAATG
ATAAAAAAACGCGTGCGAGAAAAATATAATCAAAATGGACGATCCAACGGTCAAACCTCTCAACAAAATGTCGTT
GACGATTCGGATGATAGTGATGACGATGATGATACTAATAACTATGCTAACGATAGGGGTAACAACTGA
Transcript >Agabi119p4|095750
ATGTCGTCCGACGGAAGGTATATGTATCACCACCAACCCCCGAGTATCAATAACTATGACTATGGCTATCCGCAT
CATCAACAACATCAGCCCCAACACCACCCTCCTCCGCCTCCGCCACCTCATGCCTACGATAATCACCCCCCTCCT
TCGCATTCTCAATCTCAACACCCACCTCACCCTCACTCTCATTCGCAGAGTCATTCGCAATTAGGCCACCCACCT
CTACGTGCTCCTGTTCCCCGTTCAAACTCGTCTTCGACTCATTCCCATTCTCCATCTCAACCAAATACATCTCAT
CCTCCCCCACCGCCTCCACATCAATCTCAACACCATTCGCACCATCCGCCTCCCCCGCATCAACCACCACCTTCA
CATCAACACCAGCCACCTCATTCGTATTATAATCCACCTCCACCTCATCCACCGCCTGGCTATCCCTCTAACTCT
TACATTCCGCCACAAGCTGCACCACCGCCCCCAACTCAGCACTCTCATCCTCAGTCTCACCACCCTAGTCACCCC
AATCACCCTAGTCATTGGGGAAATGAAAGTCAGTGGGGCGGTCAGTTTGCTTATGGCGCTCCTCCTTCATCACAC
CCTCCAGCATCTAGTGGCCCTCCAGATTATACCCCCGGTCCCAGTAGGCCGACGACTGGCCAGGAAAATGTGGCT
AACTCTACAAGCGCAGGACCAGATCACCATAGAGGGAGTTCGGGATACATGCCCCCTTCGCAGTCGGCGCAACCT
CCTCAGCCTCCACCTACCACGATTGAGCCCAGAAGGATCGATGTCAGGAATGATATGTCACGCATGGATAATCCA
AGAAGGGATGTGCGAGTGGATAACAGAATGAATGATCGAATGGATACAAGAATGGATCCTCCGAGAATGGAGGAT
CGAATACCCCCCCAGCACACATCGTATCATCATCCTCCACCTAATGTCCACCATCCTCAACCTTCATTACAGCAT
CCTCCACCGACGCCCGTTTCATCCGCGCCCACGCCAATACCTATTTCATCATCTTCAACAATTGCGGGTGCAACT
ACCGCTAAAAATGTTCGGGGAAGGGATTCGCCGGCTTCACATCCGGGACCTCCCCGTCCTTCTCATCCTCCTGCG
CATGTTCTACCTCCGGCGGGACCGCTGCCACCCACACATGCTACGATGACTAGCCCTCCCATGTCTGCTATTCCT
CCTGCTGCCGTTTCGCCTGGAAGCCTCGATTTTTACAAGCTTCTTGATCAATACCGCATGATTCTAGACAATAAG
GAAATGATCAGCAACAATCCAAACAAAGTTCCTTCTTTGGACTTATTGGAAAAGATGATTCAATGCGCGACCCTG
GCTTCGCATATGTTTGAGGAAGCTGCCGCCGGTGAAAGTACAACGTCGAATTATTCATCTCTCATGGGTGCGAAT
GGTGTCCCAGCCGCTGCATCGAACAACGCGAGAGAGGACACGAAAGAGTCTGTACTTAATGGACCTACGACAAAT
GGCTCTAGTGCGACCGCTACTGGTGCTCCCGCACCCGCACCCGCACCAACTTCATCAGGGCCCCCTGGTAAAAAA
CAGAAAACAGATGAAAGTAATCAGGGGCAAGGAGAAAACCACGGTCAGACGTGTTTGGGTTGTGGTGCCACTTCG
ACGCCCGAGTGGAGGCGTGGGCCCATGGGCCCCCGAACGTTGTGCAACGCGTGCGGGCTGGTTTATGCTAAAATG
ATAAAAAAACGCGTGCGAGAAAAATATAATCAAAATGGACGATCCAACGGTCAAACCTCTCAACAAAATGTCGTT
GACGATTCGGATGATAGTGATGACGATGATGATACTAATAACTATGCTAACGATAGGGGTAACAACTGA
Gene >Agabi119p4|095750
ATGTCGTCCGACGGAAGGTATATGTATCACCACCAACCCCCGAGTATCAATAACTATGACTATGGCTATCCGCAT
CATCAACAACATCAGCCCCAACACCACCCTCCTCCGCCTCCGCCACCTCATGCCTACGATAATCACCCCCCTCCT
TCGCATTCTCAATCTCAACACCCACCTCACCCTCACTCTCATTCGCAGAGTCATTCGCAATTAGGCCACCCACCT
CTACGTGCTCCTGTTCCCCGTTCAAACTCGTCTTCGACTCATTCCCATTCTCCATCTCAACCAAATACATCTCAT
CCTCCCCCACCGCCTCCACATCAATCTCAACACCATTCGCACCATCCGCCTCCCCCGCATCAACCACCACCTTCA
CATCAACACCAGCCACCTCATTCGTATTATAATCCACCTCCACCTCATCCACCGCCTGGCTATCCCTCTAACTCT
TACATTCCGCCACAAGCTGCACCACCGCCCCCAACTCAGCACTCTCATCCTCAGTCTCACCACCCTAGTCACCCC
AATCACCCTAGTCATTGGGGAAATGAAAGTCAGTGGGGCGGTCAGTTTGCTTATGGCGCTCCTCCTTCATCACAC
CCTCCAGCATCTAGTGGCCCTCCAGATTATACCCCCGGTCCCAGTAGGCCGACGACTGGCCAGGAAAATGTGGCT
AACTCTACAAGCGCAGGACCAGATCACCATAGAGGGAGTTCGGGATACATGCCCCCTTCGCAGTCGGCGCAACCT
CCTCAGCCTCCACCTACCACGATTGAGCCCAGAAGGATCGATGTCAGGAATGATATGTCACGCATGGATAATCCA
AGAAGGGATGTGCGAGTGGATAACAGAATGAATGATCGAATGGATACAAGAATGGATCCTCCGAGAATGGAGGAT
CGAATACCCCCCCAGCACACATCGTATCATCATCCTCCACCTAATGTCCACCATCCTCAACCTTCATTACAGCAT
CCTCCACCGACGCCCGTTTCATCCGCGCCCACGCCAATACCTATTTCATCATCTTCAACAATTGCGGGTGCAACT
ACCGCTAAAAATGTTCGGGGAAGGGATTCGCCGGCTTCACATCCGGGACCTCCCCGTCCTTCTCATCCTCCTGCG
CATGTTCTACCTCCGGCGGGACCGCTGCCACCCACACATGCTACGATGACTAGCCCTCCCATGTCTGCTATTCCT
CCTGCTGCCGTTTCGCCTGGAAGCCTCGATTTTTACAAGGTGCGTGTTCTATACTCAATTTGTATATGGACGTGT
GCCAATTTAGGTCGACTGATTGTTCTCACATTGATGCTACTATGACGTTTCGGATGCTGGGATTCTTTGATGTGA
ACCAAATGGATACTCGCTTGATGGGGATTTATTGGAATGCTTGGTGTCTGGTGATTGGTTGCGGTCTATGTCATG
CTTGGCTGACGCTCTTTTACGCTCTCCCACATGATGGATACGTCCGGAAACTTTATTCGACTCCGCGGACCGGTC
CTCATCTCATTGGTGCAAATTGCTTCCCCCAACGCAGCTTCTTGATCAATACCGCATGATTCTAGACAATAAGGA
AATGATCAGCAACAATCCAAACAAAGTTCCTTCTTTGGACTTATTGGAAAAGATGATTCAATGCGCGACCCTGGC
TTCGCATATGTTTGAGGAAGCTGCCGCCGGTGAAAGTACAACGTCGAATTATTCATCTCTCATGGGTGCGAATGG
TGTCCCAGCCGCTGCATCGAACAACGCGAGAGAGGACACGAAAGAGTCTGTACTTAATGGACCTACGACAAATGG
CTCTAGTGCGACCGCTACTGGTGCTCCCGCACCCGCACCCGCACCAACTTCATCAGGGCCCCCTGGTAAAAAACA
GGTATGACCAACAAACTGGTTATTTTTGACCCAATAATGACTCAATTACCTTTTCTGTTAGAAAACAGATGAAAG
TAATCAGGGGCAAGGAGAAAACCACGGTCAGACGTGTTTGGGTTGTGGTGCCACTTCGACGCCCGAGTGGAGGCG
TGGGCCCATGGGTAAGAAACCTAGCTCCCCCTTGAAGATTTTTATATATTTATATATTTTGACTGTCATTCTGCA
GGCCCCCGAACGTTGTGCAACGCGTGCGGGCTGGTTTATGCTAAAATGGTGCGTAGCGGAATGTTTACGCTCATA
TCCTGGCTTTGATATTTGTGATTTATAGATAAAAAAACGCGTGCGAGAAAAATATAATCAAAATGGACGATCCAA
CGGTCAAACCTCTCAACAAAATGTCGTTGACGATTCGGATGATAGTGATGACGATGATGATACTAATAACTATGC
TAACGATAGGGGTAACAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail