Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|094650
Gene name
Locationscaffold_06:1673951..1678419
Strand-
Gene length (bp)4468
Transcript length (bp)3252
Coding sequence length (bp)3252
Protein length (aa) 1084

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 3.6E-146 517 949
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 1.2E-79 114 453
PF14260 zf-C4pol C4-type zinc-finger of DNA polymerase delta 3.8E-18 986 1061

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 6 1083 0.0E+00
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 26 1083 0.0E+00
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 72 1079 0.0E+00
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 63 1083 0.0E+00
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 66 1078 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 6 1083 0.0E+00
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 26 1083 0.0E+00
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 72 1079 0.0E+00
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 63 1083 0.0E+00
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 66 1078 0.0E+00
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 58 1083 0.0E+00
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 73 1083 0.0E+00
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 58 1083 0.0E+00
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 56 1083 0.0E+00
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 73 1083 0.0E+00
sp|P15436|DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL3 PE=1 SV=4 38 1078 0.0E+00
sp|Q54N97|DPOD1_DICDI DNA polymerase delta catalytic subunit OS=Dictyostelium discoideum GN=pold1 PE=3 SV=1 74 1083 0.0E+00
sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD1 PE=2 SV=1 72 993 0.0E+00
sp|P90829|DPOD1_CAEEL DNA polymerase delta catalytic subunit OS=Caenorhabditis elegans GN=F10C2.4 PE=3 SV=1 74 1083 0.0E+00
sp|P30315|DPOD1_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD1 PE=3 SV=1 108 1067 0.0E+00
sp|P30321|DPOL_PBCV1 DNA polymerase OS=Paramecium bursaria Chlorella virus 1 GN=DPO PE=3 SV=2 102 952 4.0E-128
sp|P30320|DPOL_PBCVN DNA polymerase OS=Paramecium bursaria Chlorella virus NY2A GN=DPO PE=3 SV=1 102 1002 2.0E-122
sp|P03198|DPOL_EBVB9 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain B95-8) GN=BALF5 PE=1 SV=1 116 938 8.0E-117
sp|Q3KSP1|DPOL_EBVG DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain GD1) GN=BALF5 PE=3 SV=1 116 938 8.0E-117
sp|Q1HVC1|DPOL_EBVA8 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain AG876) GN=BALF5 PE=3 SV=1 116 938 1.0E-116
sp|O36363|DPOL_ALHV1 DNA polymerase catalytic subunit OS=Alcelaphine herpesvirus 1 (strain C500) GN=9 PE=3 SV=1 219 935 2.0E-109
sp|P24907|DPOL_SHV21 DNA polymerase catalytic subunit OS=Saimiriine herpesvirus 2 (strain 11) GN=9 PE=3 SV=1 39 935 6.0E-108
sp|Q2HRD0|DPOL_HHV8P DNA polymerase catalytic subunit OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF9 PE=3 SV=1 108 935 2.0E-107
sp|P28857|DPOL_HHV6U DNA polymerase catalytic subunit OS=Human herpesvirus 6A (strain Uganda-1102) GN=U38 PE=3 SV=1 108 950 1.0E-106
sp|Q9QJ32|DPOL_HHV6Z DNA polymerase catalytic subunit OS=Human herpesvirus 6B (strain Z29) GN=U38 PE=3 SV=1 108 950 4.0E-106
sp|P52367|DPOL_EHV2 DNA polymerase catalytic subunit OS=Equine herpesvirus 2 (strain 86/87) GN=9 PE=3 SV=1 108 935 4.0E-106
sp|Q69025|DPOL_GPCMV DNA polymerase OS=Guinea pig cytomegalovirus (strain 22122) GN=UL54 PE=3 SV=3 108 950 6.0E-101
sp|O71121|DPOL_RHCM6 DNA polymerase catalytic subunit OS=Rhesus cytomegalovirus (strain 68-1) GN=UL54 PE=3 SV=1 108 950 8.0E-100
sp|P52342|DPOL_HHV7J DNA polymerase catalytic subunit OS=Human herpesvirus 7 (strain JI) GN=U38 PE=3 SV=1 108 950 2.0E-97
sp|Q9DKT8|DPOL_ELHVK DNA polymerase catalytic subunit OS=Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) PE=3 SV=1 108 955 5.0E-91
sp|Q6UDK1|DPOL_PSHV1 DNA polymerase catalytic subunit OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL30 PE=3 SV=1 216 956 2.0E-88
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 286 1067 5.0E-86
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 279 1071 3.0E-85
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 279 1071 4.0E-85
sp|P27172|DPOL_MUHVS DNA polymerase catalytic subunit OS=Murid herpesvirus 1 (strain Smith) GN=UL54 PE=3 SV=1 108 950 1.0E-83
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 316 1077 6.0E-80
sp|P28858|DPOL_EHV1B DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain Ab4p) GN=30 PE=3 SV=1 216 938 6.0E-80
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 286 1069 8.0E-80
sp|Q6S6P1|DPOL_EHV1V DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain V592) GN=30 PE=3 SV=1 216 938 3.0E-79
sp|P09252|DPOL_VZVD DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Dumas) GN=ORF28 PE=3 SV=1 219 938 3.0E-76
sp|Q4JQU7|DPOL_VZVO DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF28 PE=3 SV=1 219 938 5.0E-76
sp|P09854|DPOL_HHV1S DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain SC16) GN=UL30 PE=3 SV=1 219 903 5.0E-76
sp|P04292|DPOL_HHV1K DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain KOS) GN=UL30 PE=1 SV=1 219 903 1.0E-75
sp|P04293|DPOL_HHV11 DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain 17) GN=UL30 PE=1 SV=2 219 903 1.0E-75
sp|P07917|DPOL_HHV1A DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain Angelotti) GN=UL30 PE=1 SV=1 219 903 1.0E-75
sp|P89453|DPOL_HHV2H DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain HG52) GN=UL30 PE=3 SV=1 219 903 1.0E-74
sp|P07918|DPOL_HHV21 DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain 186) GN=UL30 PE=3 SV=1 219 903 1.0E-73
sp|Q196U0|DPOL_IIV3 DNA polymerase 120R OS=Invertebrate iridescent virus 3 GN=IIV3-120R PE=3 SV=1 288 947 1.0E-72
sp|Q9E6N9|DPOL_GAHVM DNA polymerase catalytic subunit OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV043 PE=3 SV=1 108 951 1.0E-71
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 459 987 3.0E-68
sp|O70736|DPOL_RSIV DNA polymerase OS=Red sea bream iridovirus PE=3 SV=1 283 936 7.0E-61
sp|P56689|DPOL_THEGO DNA polymerase OS=Thermococcus gorgonarius GN=pol PE=1 SV=1 284 946 3.0E-60
sp|O93746|DPOL2_AERPE DNA polymerase 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polB PE=3 SV=3 85 947 4.0E-57
sp|P61876|DPOL_PYRWO DNA polymerase OS=Pyrococcus woesei GN=pol PE=1 SV=1 113 947 7.0E-57
sp|P61875|DPOL_PYRFU DNA polymerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pol PE=1 SV=1 113 947 7.0E-57
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 553 909 4.0E-56
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 553 909 5.0E-56
sp|Q56366|DPOL_THES9 DNA polymerase OS=Thermococcus sp. (strain 9oN-7) GN=pol PE=1 SV=1 103 947 2.0E-55
sp|Q9HH06|DPOL_PYRGL DNA polymerase OS=Pyrococcus glycovorans GN=pol PE=3 SV=1 284 947 4.0E-53
sp|P0CL77|DPOL_PYRAB DNA polymerase 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=polI PE=1 SV=1 284 979 5.0E-53
sp|P0CL76|DPOL_PYRAY DNA polymerase 1 OS=Pyrococcus abyssi GN=polI PE=1 SV=1 284 946 1.0E-52
sp|Q7SIG7|DPOL_DESST DNA polymerase OS=Desulfurococcus sp. (strain Tok) GN=pol PE=1 SV=1 126 946 1.0E-52
sp|P27727|DPOLA_TRYBB DNA polymerase alpha catalytic subunit OS=Trypanosoma brucei brucei PE=3 SV=1 229 965 2.0E-52
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 548 950 2.0E-52
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 361 951 4.0E-51
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 361 951 3.0E-50
sp|O29753|DPOL_ARCFU DNA polymerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pol PE=3 SV=1 220 947 6.0E-50
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 361 951 1.0E-49
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 219 951 2.0E-49
sp|Q9FHA3|DPOLA_ARATH DNA polymerase alpha catalytic subunit OS=Arabidopsis thaliana GN=POLA PE=3 SV=2 358 1041 5.0E-49
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 347 951 7.0E-48
sp|O00874|DPOLA_LEIDO DNA polymerase alpha catalytic subunit OS=Leishmania donovani PE=3 SV=1 344 1055 7.0E-48
sp|P52025|DPOL_METVO DNA polymerase OS=Methanococcus voltae GN=pol PE=3 SV=1 218 949 2.0E-47
sp|Q94636|DPOLA_STENO DNA polymerase alpha catalytic subunit OS=Sterkiella nova PE=3 SV=1 193 951 4.0E-47
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 219 957 1.0E-44
sp|Q54SV8|DPOLA_DICDI DNA polymerase alpha catalytic subunit OS=Dictyostelium discoideum GN=pola1 PE=3 SV=1 337 949 6.0E-44
sp|P26019|DPOLA_DROME DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster GN=DNApol-alpha180 PE=1 SV=2 228 972 1.0E-43
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 625 950 2.0E-43
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 340 957 2.0E-43
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 625 950 2.0E-43
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 214 600 1.0E-42
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 214 600 1.0E-42
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 229 949 3.0E-39
sp|A7U6F3|DPOL_PPV01 DNA polymerase OS=Phaeocystis pouchetii virus GN=dpo PE=3 SV=1 431 771 2.0E-38
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 451 716 2.0E-37
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 103 601 9.0E-35
sp|O27276|DPOL1_METTH DNA polymerase PolB subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB1 PE=1 SV=1 220 742 1.0E-34
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 269 679 6.0E-33
sp|P21189|DPO2_ECOLI DNA polymerase II OS=Escherichia coli (strain K12) GN=polB PE=1 SV=2 365 960 3.0E-30
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 695 950 1.0E-29
sp|O05706|DPOL3_SULSH DNA polymerase 3 OS=Sulfolobus shibatae GN=dpo3 PE=3 SV=1 108 957 7.0E-29
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 286 679 4.0E-28
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 108 716 8.0E-28
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 462 608 3.0E-27
sp|Q4U3V0|DPOL_TNAVC DNA polymerase OS=Trichoplusia ni ascovirus 2c GN=ORF1 PE=3 SV=2 631 949 6.0E-27
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 126 679 2.0E-26
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 160 679 5.0E-26
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 625 863 1.0E-25
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 631 862 1.0E-25
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 632 878 3.0E-25
sp|P42489|DPOL_ASFB7 DNA polymerase beta OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=DPOL PE=3 SV=1 89 936 4.0E-25
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 91 465 2.0E-24
sp|P0C972|DPOL_ASFM2 DNA polymerase beta OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-098 PE=3 SV=1 89 936 5.0E-24
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 728 953 9.0E-24
sp|P0C974|DPOL_ASFK5 DNA polymerase beta OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-102 PE=3 SV=1 89 936 1.0E-23
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 228 545 2.0E-23
sp|P0C971|DPOL_ASFP4 DNA polymerase beta OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=DPOL PE=3 SV=1 89 936 4.0E-23
sp|P0C973|DPOL_ASFWA DNA polymerase beta OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-100 PE=3 SV=1 89 936 4.0E-23
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 300 459 5.0E-23
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 108 554 5.0E-23
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 108 554 5.0E-23
sp|P43139|DPOL_ASFL6 DNA polymerase beta OS=African swine fever virus (isolate Pig/Portugal/Lis 60/1960) GN=DPOL PE=3 SV=1 89 936 9.0E-23
sp|Q6WI70|DPOL_BPKVM DNA polymerase OS=Vibrio phage KVP40 (isolate Vibrio parahaemolyticus/Japan/Matsuzaki/1991) GN=43 PE=3 SV=1 283 840 2.0E-22
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 631 832 3.0E-21
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 222 648 1.0E-20
sp|P95979|DPOL3_SULSO DNA polymerase 3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dpo3 PE=3 SV=1 91 957 4.0E-20
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 203 601 6.0E-20
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 675 949 7.0E-20
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 325 590 9.0E-20
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 299 467 2.0E-19
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 91 465 2.0E-18
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 692 946 3.0E-18
sp|O57191|DPOL_VACCA DNA polymerase OS=Vaccinia virus (strain Ankara) GN=POL PE=3 SV=1 484 852 9.0E-18
sp|P33793|DPOL_VAR67 DNA polymerase OS=Variola virus (isolate Human/India/Ind3/1967) GN=POL PE=3 SV=1 484 852 9.0E-18
sp|P20509|DPOL_VACCC DNA polymerase OS=Vaccinia virus (strain Copenhagen) GN=POL PE=3 SV=1 484 852 9.0E-18
sp|P06856|DPOL_VACCW DNA polymerase OS=Vaccinia virus (strain Western Reserve) GN=POL PE=1 SV=5 484 852 1.0E-17
sp|P26811|DPOL1_SULSO DNA polymerase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dpo1 PE=1 SV=2 281 950 1.0E-17
sp|O50607|DPOL1_SULOH DNA polymerase 1 OS=Sulfurisphaera ohwakuensis GN=pol-alpha PE=3 SV=1 143 818 3.0E-17
sp|Q84173|DPOL_ORFN2 DNA polymerase OS=Orf virus (strain NZ2) GN=POL PE=3 SV=1 484 831 4.0E-17
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 577 753 6.0E-17
sp|P30318|DPOL_NPVLD DNA polymerase OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=POL PE=3 SV=2 282 748 3.0E-16
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 631 756 3.0E-15
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 127 617 7.0E-15
sp|Q83948|DPOL_NPVOP DNA polymerase OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=POL PE=3 SV=1 269 892 8.0E-15
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 126 617 2.0E-14
sp|P18131|DPOL_NPVAC DNA polymerase OS=Autographa californica nuclear polyhedrosis virus GN=POL PE=3 SV=2 281 774 2.0E-14
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 692 947 4.0E-14
sp|P95690|DPOL1_SULAC DNA polymerase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=dpo1 PE=1 SV=2 341 792 5.0E-14
sp|P41712|DPOL_NPVBM DNA polymerase OS=Bombyx mori nuclear polyhedrosis virus GN=POL PE=3 SV=2 281 776 6.0E-14
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 286 617 8.0E-14
sp|P21402|DPOL_FOWPN DNA polymerase OS=Fowlpox virus (strain NVSL) GN=POL PE=3 SV=2 559 956 8.0E-14
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 692 947 9.0E-14
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 104 303 1.0E-13
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 284 617 1.0E-13
sp|O93745|DPOL1_AERPE DNA polymerase 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polA PE=3 SV=2 368 791 2.0E-12
sp|A7U6F3|DPOL_PPV01 DNA polymerase OS=Phaeocystis pouchetii virus GN=dpo PE=3 SV=1 103 303 7.0E-12
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 483 605 7.0E-12
sp|P04415|DPOL_BPT4 DNA polymerase OS=Enterobacteria phage T4 GN=43 PE=1 SV=1 345 751 6.0E-10
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 754 947 1.0E-09
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 720 947 1.0E-09
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 720 946 2.0E-09
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 722 947 2.0E-09
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 701 947 5.0E-09
sp|Q38087|DPOL_BPR69 DNA polymerase OS=Enterobacteria phage RB69 GN=43 PE=1 SV=1 345 740 1.0E-08
sp|Q90162|DPOL_NPVCF DNA polymerase OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=POL PE=3 SV=1 228 502 3.0E-08
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 106 317 2.0E-07
sp|Q90162|DPOL_NPVCF DNA polymerase OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=POL PE=3 SV=1 559 911 3.0E-07
sp|O26310|DPOL2_METTH DNA polymerase PolB subunit 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB2 PE=1 SV=1 761 966 3.0E-07
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 577 679 4.0E-06
sp|Q07864|DPOE1_HUMAN DNA polymerase epsilon catalytic subunit A OS=Homo sapiens GN=POLE PE=1 SV=5 220 575 6.0E-06
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 577 679 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|094650
MPYSKKEKKPLERTQTLNGEEIEEGPAVKKRKLGNGASTLQGVQSQPSFADVLEKLKEEEGTNAPEAEGGANRWG
RPRLDEIDPDQDSIVFQQIDVEEGVDGNGHFGIRMYGVTQEGHSVMALITDFLPYFYIAVPRGFQDEDMTAFKGY
LNQTVGSNVVQKVEKLAKRTLWGYRGDDKVSFLKLTISDPKSLPRVRGLFERAECQFQGLFPSEPVPTFESNIVF
TLRFMIDTKVVGMNWIEVPPGKYKLVTSQHKRSHCQIELRMRYDAFVSHPPEGAWSKIAPLRILSFDIECAGRKG
IFPEAQTDPVIQIANMVTRHGEDKPFIRNVFNLNTCANIVGSQVLTFTEEAPLFQAWRDFVEEVDPDVITGYNIA
NFDFPYLMDRAKALEVANFNYLGRLRNVRTEVKNTHFSSRAYGQRDSKETPLYGRLQMDILQFMQREHKLRSYTL
NSVCAQFLGEQKEDVHHSVITELYNGTPESRRRLAVYCLKDAYLPQRLLDKLMCFVNYTEMARVTGVPFNYLLSR
GQSIKVLSQLFRKANEEGYVIPALKGEGTDGEAYEGATVIEPKKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLI
EGSMIEKLDLVKDVDYIQTPNNDFFVTSMKRKGLLPTILEDLISARKRAKADLKMEKDPFKKAVLDGRQLALKIS
ANSVYGFTGATVGKLPCLPISSSVTAYGRQMIEKTKQEVEAEFCIANGHQYDARVIYGDTDSVMVKFGQNDLAQV
MALGSEAAEFVSAKFIKPIKLEFEKVYYPYLLISKKRYAGLYWTKAEKYDKMDSKGIETVRRDNCRLVSTVIETS
LHKLLIDRDVKAAEIYVKQMIADLLQNKVDMSQLVITKALSKTDYAGKQAHVELAERMKQRDAGSAPALGDRVAY
VIIKGIKGAAAYEKSEDPLYVLENSIPIDTKYYLENQLSKPLMRIFEPILGEKASSLLSGDHTRTIQIATPTVGG
LMKFAVKTVTCLGCKTALKTNNSIANGAICNNCRPRISELYQKQVMSTSELQVRFARLWTQCQRCQGSLHQDVLC
TSKDCPIFYMRKKAQKDAEDANTALERFDDEAW*
Coding >Agabi119p4|094650
ATGCCTTACTCAAAGAAGGAAAAGAAGCCTCTTGAACGAACACAAACACTGAACGGCGAGGAGATTGAAGAAGGT
CCGGCAGTAAAGAAGAGGAAATTAGGGAACGGGGCATCTACGTTGCAGGGCGTACAGTCTCAGCCCTCGTTTGCC
GATGTACTAGAAAAGTTGAAGGAAGAAGAGGGTACAAATGCACCCGAGGCGGAGGGTGGAGCAAACCGCTGGGGA
CGCCCAAGACTAGACGAAATCGATCCTGACCAGGACTCCATAGTGTTTCAGCAGATTGATGTGGAGGAAGGCGTT
GATGGTAATGGCCACTTCGGAATTCGGATGTATGGAGTAACACAGGAGGGCCACAGTGTTATGGCTTTAATCACA
GATTTCTTGCCCTATTTTTATATTGCAGTTCCCCGAGGTTTTCAAGACGAAGACATGACTGCGTTCAAAGGATAC
CTTAATCAAACCGTTGGTAGTAATGTTGTTCAAAAGGTGGAGAAACTTGCCAAGCGGACACTCTGGGGTTACAGA
GGGGATGATAAGGTTTCTTTCCTCAAGCTGACAATCAGTGATCCAAAGAGTTTACCAAGAGTCAGAGGTCTCTTT
GAACGTGCAGAATGCCAGTTCCAAGGCCTCTTCCCATCGGAACCTGTACCTACCTTCGAAAGCAATATTGTCTTC
ACACTTAGGTTCATGATCGATACGAAGGTTGTTGGAATGAACTGGATCGAGGTGCCGCCCGGAAAGTACAAATTG
GTAACTTCACAACACAAACGATCTCACTGCCAGATTGAGCTACGTATGAGATACGACGCCTTTGTTTCACATCCT
CCAGAAGGTGCTTGGTCAAAGATTGCTCCGCTGCGGATCCTGAGTTTCGACATTGAGTGTGCGGGTAGAAAAGGG
ATTTTTCCCGAGGCTCAAACTGATCCTGTCATCCAGATTGCGAATATGGTGACGAGACACGGGGAAGACAAACCT
TTCATCCGCAACGTCTTCAACCTCAATACATGCGCGAATATTGTTGGATCGCAAGTTTTGACCTTCACAGAAGAA
GCGCCTCTGTTCCAGGCATGGCGAGATTTCGTTGAAGAAGTTGACCCAGATGTGATAACTGGATACAATATCGCA
AATTTCGATTTTCCTTACCTAATGGATCGAGCGAAAGCGCTTGAAGTGGCCAACTTCAACTACTTGGGTCGTTTG
AGAAACGTCAGGACTGAAGTAAAAAATACCCACTTCTCTTCAAGGGCTTATGGTCAACGGGATTCCAAGGAAACC
CCGCTCTATGGTCGGCTCCAGATGGATATCCTCCAATTCATGCAGCGAGAGCACAAACTACGAAGTTATACTCTG
AATTCAGTCTGTGCACAGTTTTTGGGGGAGCAGAAGGAAGATGTGCACCATTCGGTTATCACAGAATTATACAAC
GGCACCCCAGAGTCGCGCCGTCGATTGGCGGTGTACTGCTTGAAGGACGCATATCTGCCGCAGAGATTGTTGGAT
AAGCTTATGTGCTTCGTCAACTACACAGAAATGGCACGTGTAACGGGAGTGCCGTTTAATTATCTACTATCTCGT
GGCCAAAGTATCAAGGTACTTTCACAGCTGTTCAGAAAGGCAAATGAAGAAGGTTATGTCATTCCGGCATTAAAG
GGGGAAGGTACCGATGGAGAAGCTTATGAAGGAGCCACAGTGATAGAACCGAAGAAAGGTTATTATGACGTGCCA
ATCGCAACTCTCGATTTTAGTTCCCTATACCCTTCAATCATGATGGCGCACAATCTTTGTTACACCACACTGATC
GAGGGAAGCATGATCGAGAAACTGGATCTCGTGAAAGATGTTGACTACATCCAGACACCGAATAATGATTTCTTT
GTAACCTCGATGAAAAGGAAGGGCTTGTTACCAACAATTCTCGAGGACCTCATTTCTGCTCGCAAGCGTGCGAAG
GCCGATCTTAAGATGGAGAAGGATCCATTCAAGAAGGCCGTACTTGATGGTCGACAGTTGGCACTTAAGATTAGT
GCAAACTCAGTGTATGGTTTTACAGGTGCCACCGTGGGCAAGCTTCCTTGCCTGCCCATCTCATCCAGTGTGACG
GCTTATGGCCGTCAAATGATTGAGAAAACGAAACAAGAAGTCGAGGCCGAATTTTGTATCGCTAATGGGCACCAA
TATGACGCGCGGGTGATTTACGGAGATACTGATTCCGTCATGGTCAAGTTTGGGCAGAATGACCTTGCCCAAGTC
ATGGCTCTCGGGAGCGAAGCCGCCGAATTCGTTTCCGCAAAATTTATCAAGCCGATCAAGCTTGAGTTCGAGAAG
GTGTATTATCCGTACTTGCTCATCAGTAAGAAACGATATGCAGGTTTGTACTGGACCAAGGCAGAAAAGTATGAC
AAAATGGACTCGAAGGGCATTGAGACTGTCCGTCGAGATAATTGCAGACTGGTGTCGACAGTCATCGAGACAAGT
CTTCACAAGCTTTTGATTGATAGAGATGTCAAAGCTGCTGAAATCTACGTCAAGCAAATGATTGCCGACCTGTTA
CAAAACAAGGTTGATATGTCTCAACTAGTGATCACAAAAGCACTGTCAAAAACGGACTATGCTGGAAAACAGGCA
CACGTTGAGCTGGCAGAACGAATGAAACAGCGTGATGCCGGATCTGCACCAGCACTCGGAGATCGTGTTGCCTAT
GTTATAATCAAGGGTATAAAAGGCGCCGCAGCATACGAAAAGTCCGAAGATCCTCTTTACGTTTTGGAAAACAGT
ATACCGATCGATACGAAATACTACCTCGAGAACCAACTTTCAAAACCATTGATGAGAATTTTCGAACCTATTCTC
GGAGAAAAGGCTTCTTCTCTGTTGTCTGGTGACCATACAAGGACAATACAAATTGCGACACCCACTGTAGGTGGC
CTCATGAAATTCGCCGTCAAAACCGTTACATGCCTCGGTTGTAAAACAGCCTTAAAGACGAATAACAGCATTGCT
AATGGTGCTATCTGCAATAATTGTCGGCCCAGAATCTCGGAACTTTACCAAAAGCAAGTCATGTCGACTTCGGAG
CTACAGGTACGATTTGCACGGTTGTGGACCCAGTGCCAGAGATGCCAGGGATCCCTACATCAGGATGTCTTGTGT
ACAAGCAAAGATTGCCCAATATTCTACATGAGAAAGAAGGCACAGAAGGACGCCGAGGATGCTAATACAGCCTTA
GAACGGTTTGATGACGAGGCTTGGTGA
Transcript >Agabi119p4|094650
ATGCCTTACTCAAAGAAGGAAAAGAAGCCTCTTGAACGAACACAAACACTGAACGGCGAGGAGATTGAAGAAGGT
CCGGCAGTAAAGAAGAGGAAATTAGGGAACGGGGCATCTACGTTGCAGGGCGTACAGTCTCAGCCCTCGTTTGCC
GATGTACTAGAAAAGTTGAAGGAAGAAGAGGGTACAAATGCACCCGAGGCGGAGGGTGGAGCAAACCGCTGGGGA
CGCCCAAGACTAGACGAAATCGATCCTGACCAGGACTCCATAGTGTTTCAGCAGATTGATGTGGAGGAAGGCGTT
GATGGTAATGGCCACTTCGGAATTCGGATGTATGGAGTAACACAGGAGGGCCACAGTGTTATGGCTTTAATCACA
GATTTCTTGCCCTATTTTTATATTGCAGTTCCCCGAGGTTTTCAAGACGAAGACATGACTGCGTTCAAAGGATAC
CTTAATCAAACCGTTGGTAGTAATGTTGTTCAAAAGGTGGAGAAACTTGCCAAGCGGACACTCTGGGGTTACAGA
GGGGATGATAAGGTTTCTTTCCTCAAGCTGACAATCAGTGATCCAAAGAGTTTACCAAGAGTCAGAGGTCTCTTT
GAACGTGCAGAATGCCAGTTCCAAGGCCTCTTCCCATCGGAACCTGTACCTACCTTCGAAAGCAATATTGTCTTC
ACACTTAGGTTCATGATCGATACGAAGGTTGTTGGAATGAACTGGATCGAGGTGCCGCCCGGAAAGTACAAATTG
GTAACTTCACAACACAAACGATCTCACTGCCAGATTGAGCTACGTATGAGATACGACGCCTTTGTTTCACATCCT
CCAGAAGGTGCTTGGTCAAAGATTGCTCCGCTGCGGATCCTGAGTTTCGACATTGAGTGTGCGGGTAGAAAAGGG
ATTTTTCCCGAGGCTCAAACTGATCCTGTCATCCAGATTGCGAATATGGTGACGAGACACGGGGAAGACAAACCT
TTCATCCGCAACGTCTTCAACCTCAATACATGCGCGAATATTGTTGGATCGCAAGTTTTGACCTTCACAGAAGAA
GCGCCTCTGTTCCAGGCATGGCGAGATTTCGTTGAAGAAGTTGACCCAGATGTGATAACTGGATACAATATCGCA
AATTTCGATTTTCCTTACCTAATGGATCGAGCGAAAGCGCTTGAAGTGGCCAACTTCAACTACTTGGGTCGTTTG
AGAAACGTCAGGACTGAAGTAAAAAATACCCACTTCTCTTCAAGGGCTTATGGTCAACGGGATTCCAAGGAAACC
CCGCTCTATGGTCGGCTCCAGATGGATATCCTCCAATTCATGCAGCGAGAGCACAAACTACGAAGTTATACTCTG
AATTCAGTCTGTGCACAGTTTTTGGGGGAGCAGAAGGAAGATGTGCACCATTCGGTTATCACAGAATTATACAAC
GGCACCCCAGAGTCGCGCCGTCGATTGGCGGTGTACTGCTTGAAGGACGCATATCTGCCGCAGAGATTGTTGGAT
AAGCTTATGTGCTTCGTCAACTACACAGAAATGGCACGTGTAACGGGAGTGCCGTTTAATTATCTACTATCTCGT
GGCCAAAGTATCAAGGTACTTTCACAGCTGTTCAGAAAGGCAAATGAAGAAGGTTATGTCATTCCGGCATTAAAG
GGGGAAGGTACCGATGGAGAAGCTTATGAAGGAGCCACAGTGATAGAACCGAAGAAAGGTTATTATGACGTGCCA
ATCGCAACTCTCGATTTTAGTTCCCTATACCCTTCAATCATGATGGCGCACAATCTTTGTTACACCACACTGATC
GAGGGAAGCATGATCGAGAAACTGGATCTCGTGAAAGATGTTGACTACATCCAGACACCGAATAATGATTTCTTT
GTAACCTCGATGAAAAGGAAGGGCTTGTTACCAACAATTCTCGAGGACCTCATTTCTGCTCGCAAGCGTGCGAAG
GCCGATCTTAAGATGGAGAAGGATCCATTCAAGAAGGCCGTACTTGATGGTCGACAGTTGGCACTTAAGATTAGT
GCAAACTCAGTGTATGGTTTTACAGGTGCCACCGTGGGCAAGCTTCCTTGCCTGCCCATCTCATCCAGTGTGACG
GCTTATGGCCGTCAAATGATTGAGAAAACGAAACAAGAAGTCGAGGCCGAATTTTGTATCGCTAATGGGCACCAA
TATGACGCGCGGGTGATTTACGGAGATACTGATTCCGTCATGGTCAAGTTTGGGCAGAATGACCTTGCCCAAGTC
ATGGCTCTCGGGAGCGAAGCCGCCGAATTCGTTTCCGCAAAATTTATCAAGCCGATCAAGCTTGAGTTCGAGAAG
GTGTATTATCCGTACTTGCTCATCAGTAAGAAACGATATGCAGGTTTGTACTGGACCAAGGCAGAAAAGTATGAC
AAAATGGACTCGAAGGGCATTGAGACTGTCCGTCGAGATAATTGCAGACTGGTGTCGACAGTCATCGAGACAAGT
CTTCACAAGCTTTTGATTGATAGAGATGTCAAAGCTGCTGAAATCTACGTCAAGCAAATGATTGCCGACCTGTTA
CAAAACAAGGTTGATATGTCTCAACTAGTGATCACAAAAGCACTGTCAAAAACGGACTATGCTGGAAAACAGGCA
CACGTTGAGCTGGCAGAACGAATGAAACAGCGTGATGCCGGATCTGCACCAGCACTCGGAGATCGTGTTGCCTAT
GTTATAATCAAGGGTATAAAAGGCGCCGCAGCATACGAAAAGTCCGAAGATCCTCTTTACGTTTTGGAAAACAGT
ATACCGATCGATACGAAATACTACCTCGAGAACCAACTTTCAAAACCATTGATGAGAATTTTCGAACCTATTCTC
GGAGAAAAGGCTTCTTCTCTGTTGTCTGGTGACCATACAAGGACAATACAAATTGCGACACCCACTGTAGGTGGC
CTCATGAAATTCGCCGTCAAAACCGTTACATGCCTCGGTTGTAAAACAGCCTTAAAGACGAATAACAGCATTGCT
AATGGTGCTATCTGCAATAATTGTCGGCCCAGAATCTCGGAACTTTACCAAAAGCAAGTCATGTCGACTTCGGAG
CTACAGGTACGATTTGCACGGTTGTGGACCCAGTGCCAGAGATGCCAGGGATCCCTACATCAGGATGTCTTGTGT
ACAAGCAAAGATTGCCCAATATTCTACATGAGAAAGAAGGCACAGAAGGACGCCGAGGATGCTAATACAGCCTTA
GAACGGTTTGATGACGAGGCTTGGTGA
Gene >Agabi119p4|094650
ATGCCTTACTCAAAGAAGGAAAAGAAGCCTCTTGAACGAACACAGTGCGTCAACTTCCCGTATTTTGCGTGCTTA
TTCTTTCCCGCTAAGTCGACGCTGCTTAATCAGAACACTGAACGGCGAGGAGATTGAAGAAGGTCCGGCAGTAAA
GAAGAGGAAATTAGGGAACGGGGCATCTACGTTGCAGGGCGTACAGTCTCAGCCCTCGTTTGCCGATGTACTAGA
AAAGTTGAAGGAAGAAGAGGGTACAAATGCACCCGGTATGGTTGGCCTTTCGTGTAGTGAAAAGTCAGCTTATTC
TCAGGAATTTTGTAGAGGCGGAGGGTGGAGCAAACCGCTGGGGACGCCCAAGACTAGACGAAATCGATCCTGACC
AGGACTCCATAGGTCAATCTATCGAATTCTTCTCTATCCAGATTCCGCTGACATTCCTCAGTGTTTCAGCAGATT
GATGTGGAGGAAGGCGTTGATGGTAATGGCCACTTCGGAATTCGGATGTATGGAGTAACACAGGTAAGCTCCCCA
TGCAGCACCTTTTGATTCATCTTTTCTGATCATTCGTTGTTCAGGAGGGCCACAGTGTTATGGCTTTAATCACAG
ATTTCTTGCCCTATTTTTATATTGCAGTTCCCCGAGGTTTTCAAGACGAAGACATGACTGCGTTCAAAGGATACC
TTAATGTGGGTCAACAAGAGTCGTGTTTCGTTTGCTCTTACTCAAATAGTGAAGCAAACCGTTGGTAGTAATGTT
GTTCAAAAGGTGGAGAAACTTGCCAAGCGGACACTCTGGGGTTACAGAGGGGATGATAAGGTTTCTTTCCTCAAG
CTGACAATCAGTGATCCAAAGAGTTTACCAAGAGTCAGAGATGAGTAATTTGGTCCAGCCTCGTATGGCCCTTCA
AACTTATACGCCGGCTCTTTACGTCTCTTTGAACGTGCAGAATGCCAGTTCCAAGGCCTCTTCCCATCGGAACCT
GTACCTACCTTCGAAAGCAATATTGTCTTCACACTTAGGTTCATGATCGATACGAAGGTAACTGATTTATCGTTG
CATCCCCTCACGTATTAACATCCCTTAGGTTGTTGGAATGAACTGGATCGAGGTGCCGCCCGGAAAGTACAAATT
GGTAACTTCACAACACAAACGATCTCACTGCCAGATTGAGCTACGTATGAGGTAGGATCATTTTAAAATTCAGCA
GTTTCGAGCTTCATGGTTTCACAGATACGACGCCTTTGTTTCACATCCTCCAGAAGGTGCTTGGTCAAAGATTGC
TCCGCTGCGGATCCTGAGTTTCGACATTGAGTGTGCGGGTAGAAAAGGGATTTTTCCCGAGGCTCAAACTGATCC
TGTCATCCAGATTGCGAATATGGTGACGAGACACGGTAACTTCCAGCATTAATTCGATTGCTGGCTCTAGTTAAT
TGCTGACAGGGGAAGACAAACCTTTCATCCGCAACGTCTTCAACCTCAATACATGCGCGAATATTGTTGGATCGC
AAGTTTTGACCTTCACAGAAGAAGCGCCTCTGTTCCAGGCATGGCGAGATTTCGTTGAAGAAGTTGACCCAGATG
TGATAACTGGATACAATATCGCAAATTTCGATTTTCCTTACCTAATGGATCGAGCGAAAGCGCTTGAAGTGGCCA
ACTTCAACTACTTGGGTCGTTTGAGAAGTGCGCACCAAGCTTTGACGGCTCGAACTGTTATGCTGAAATCGTTCT
CTCTAGACGTCAGGACTGAAGTAAAAAATACCCACTTCTCTTCAAGGGCTTATGGTCAACGGGATTCCAAGGAAA
CCCCGCTCTATGGTCGGCTCCAGATGGATATCCTCCAATTCATGCAGCGAGAGCACAAACTACGAAGTTATACTC
TGAATTCAGTCTGTGCACAGTTTTTGGGGGAGCAGAAGGAAGATGTGCACCATTCGGTTATCACAGAATTATACA
ACGGCACCCCAGAGTCGCGCCGTCGATTGGCGGTGTACTGCTTGAAGGTATGCATCGGCGAATTTATTCTAGATT
CGATAACTTGACCATCATGTTGGGTAGGACGCATATCTGCCGCAGAGATTGTTGGATAAGCTTATGTGCTTCGTC
AACTACACAGAAATGGCACGTGTAACGGGAGTGCCGTTTAATTATCTACTATCTCGTGGCCAAAGTATCAAGGTA
CTTTCACAGCTGTTCAGAAAGGCAAATGAAGAAGGTTATGTCATTCCGGCATTAAAGGGGGAAGGTGAGGGTAAT
CTTATTATGATATAATGCTGACTTCTTCACATCTTGAAGGTACCGATGGAGAAGCTTATGAAGGAGCCACAGTGA
TAGAACCGAAGAAAGGTTATTATGACGTGCCAATCGCAACTCTCGATTTTAGTTCCCTATACCCTTCAATCATGA
TGGCGCACAATCTTTGTTACACCACACTGATCGAGGGAAGCATGATCGAGAAACTGGATCTCGTGAAAGATGTTG
ACTACATCCAGACACCGAATAATGGTAGGTACTTGAGGACTTATTTTTTTATCTGTTCTAACTTCGGCTAGATTT
CTTTGTAACCTCGATGAAAAGGAAGGGCTTGTTACCAACAATTCTCGAGGACCTCATTTCTGCTCGCAAGCGTGC
GAAGGCCGATCTTAAGATGGAGAAGGATCCATTCAAGAAGGCCGTACTTGATGGTCGACAGTTGGCACTTAAGGT
ATACAGGATTGCTTCCAAGCTGCAGCATAGGTATTGATTTTGAACAGATTAGTGCAAACTCAGTGTATGGTTTTA
CAGGTGCCACCGTGGGCAAGCTTCCTTGCCTGCCCATCTCATCCAGTGTGACGGCTTATGGCCGTCAAATGATTG
AGAAAACGAAACAAGTACGCTGACTTCTCTTTTCCCGGAAAGCCAAAAGGAGATTGACGGGCATAACAGGAAGTC
GAGGCCGAATTTTGTATCGCTAATGGGCACCAATATGACGCGCGGGTGATTTACGGAGATACTGATTCCGTCATG
GTCAAGTTTGGGCAGAATGACCTTGCCCAAGTCATGGCTCTCGGTATGCAGTTCGATTTTCTGGCAAATAATTCG
TCACCAATAGGCGCAATCATTTCTAGGGAGCGAAGCCGCCGAATTCGTTTCCGCAAAATTTATCAAGCCGATCAA
GCTTGAGTTCGAGAAGGTGTATTATCCGTACTTGCTCATCAGTAAGAAACGATATGCAGGTTTGTACTGGACCAA
GGCAGAAAAGTATGACAAAATGGACTCGAAGGGCATTGAGGTATGTTATTGATGGTTTCATGAATAATCAACATT
TGGATGATGAACATCCTTAGACTGTCCGTCGAGATAATTGCAGACTGGTGTCGACAGTCATCGAGACAAGTCTTC
ACAAGCTTTTGATTGATAGAGATGTCAAAGCTGCTGAAATGTTCGTTCCTATGTCTACGCCACAAAACCGTGCTT
GATCTTCTCATTTCAGCTACGTCAAGCAAATGATTGCCGACCTGTTACAAAACAAGGTTGATATGTCTCAACTAG
TGATCACAAAAGCACTGTCAAAAACGGGTCAGTCTAACAGAGCATAAAGCCTGGATTGCAATTGAAATGAACTTC
GAATACAGACTATGCTGGAAAACAGGCACACGTTGAGCTGGCAGAACGAATGAAACAGCGTGATGCCGGATCTGC
ACCAGCACTCGGAGATCGTGTTGCCTATGTTATAATCAAGGGTATAAAAGGTGCACCTTATCGCATATGGAAAAG
ATGATTTCGCAAGCTAATTCTGACTTCATCAACAGGCGCCGCAGCATACGAAAAGTCCGAAGATCCTCTTTACGT
TTTGGAAAACAGTATACCGATCGATACGAAATACTACCTCGAGAACCAACTTTCAAAACCATTGATGAGAATTTT
CGAACCTATTCTCGGAGAAAAGGCTTCTTCTCTGTGTAAGCCCTTGACACTTGTTTCGAAAGGAGTTCTGACAAG
TTCAATAGTGTCTGGTGACCATACAAGGACAATACAAATTGCGACACCCACTGTAGGTGGCCTCATGAAATTCGC
CGTCAAAACCGTTACATGCCTCGGTTGTAAAACAGCCTTAAAGACGAATAACAGCATTGCTAGTGAGTTTCTATA
CGGTCGTGTCCGCCGGCCTTGATCTGAGGCACTTGCAATTAGATGGTGCTATCTGCAATAATTGTCGGCCCAGAA
TCTCGGAACTTTACCAAAAGCAAGTCATGTCGACTTCGGAGCTACAGGTACGATTTGCACGGTTGTGGACCCAGT
GCCAGAGATGCCAGGGATCCCTACATCAGGTATATCGTGAATTTTTCGGTATGATTATATCAATGCTAAGAGTGC
GTAGGATGTCTTGTGTACAAGCAAAGATTGCCCAATATTCTACATGAGAAAGAAGGCACAGAAGGACGCCGAGGA
TGCTAATACAGCCTTAGAACGGTTTGATGACGAGGCTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail