Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|093830
Gene name
Locationscaffold_06:1423296..1428627
Strand-
Gene length (bp)5331
Transcript length (bp)4698
Coding sequence length (bp)4698
Protein length (aa) 1566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14701 hDGE_amylase Glycogen debranching enzyme, glucanotransferase domain 5.4E-165 187 617
PF06202 GDE_C Amylo-alpha-1,6-glucosidase 4.4E-120 1089 1556
PF14702 hGDE_central Central domain of human glycogen debranching enzyme 6.6E-86 774 1015
PF14699 hGDE_N N-terminal domain from the human glycogen debranching enzyme 2.5E-20 73 159

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06625|GDE_YEAST Glycogen debranching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDB1 PE=1 SV=1 47 1562 0.0E+00
sp|A8BQB4|GDE_HORSE Glycogen debranching enzyme OS=Equus caballus GN=AGL PE=2 SV=1 91 1562 0.0E+00
sp|Q2PQH8|GDE_CANLF Glycogen debranching enzyme OS=Canis lupus familiaris GN=AGL PE=2 SV=1 91 1562 0.0E+00
sp|P35574|GDE_RABIT Glycogen debranching enzyme OS=Oryctolagus cuniculus GN=AGL PE=1 SV=1 91 1562 0.0E+00
sp|P35573|GDE_HUMAN Glycogen debranching enzyme OS=Homo sapiens GN=AGL PE=1 SV=3 91 1562 0.0E+00

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|093830
MAENRPVVSIAPDAGPGLLSPKTPADRALEFFSSSTQSDAPIVVYELSLDPDGGPNKDCQYIRLPPPYVPYILRV
SSAAGTPASNNGIFKTNFPLDGGVFGRNRYTQRKLPTDYSKPIQVDLPISHAGAFIYWVEYDGDDGQRIKGRHGY
FNVDPVLQIKSRTPVLDGNLKVLPPGQGANITDKYVNLPLDGLSILTVVSKWMGTMDHWRDHFAEAKERGYTMLH
YTPLQERGESNSPYSIRDQMKYDSTLFVKSPDNGSGKERVVEVLKLAREEYGLLSLTDVVLNHTANNSPWLVDHP
EAGFSPKNTPHLSPALELDTALIDFSDKVASRGLPSAINSEADLHCLVSALEEDLKALNLWQYYVLDPSREKNSI
ITSLTSGKFKPWTGQDVRGKTDVELAEILRSQQLITGLGQLGSRFGVHVDSAVSAGLMKAALPEIQDNDVLAEAW
IKAVDVINVPLYSEWEEDMRAALDNIRNRVKYTRLDPNGPKLKEISKKNPLVEPYFTRVLPKSDTDPFTYSLANN
GWIWNADPLQNFALLPSKAYLRREVIVWGDCVKLRYGKSPESNPWLWSYMRDYVTSLAETFDGFRIDNCHSTPLE
VGTYMLDAAREMRPDLYVCAELFTGNEETDLLFVRELGINSLVRESYNGWDPKELSRLLYRHGVGKPIGSMDGVC
MTSMEEIVSPTGKGLTRPALVTPLNGSVPHALLYDLTHDNESPLHKRSAEDALSTGALATFSYSAIGSVKGFDDL
YPKLLNLVQEDRKYRITGTGKGSGIAKVKRILNELHLEMVLGRYEEGHVHQENDYIVLHRVQPSTQKGYLLVAHT
AFSKGSKDRGYITPIKLRRTHAKFIMGASLNIESYSDSKDKEFLDGLPAVLEELPEVIASQGIDNESPYSEIVVP
DTFPPGSVMLFQTQLQDYDPSLDAFCTSGAEKAFRGLDLVDLNIVLYRAEGEERDATDGVFGVYDIPDLGKNVYC
GLEGWMHALRHIMRYNDLGHPLCGHLREGTWALDYVHQRLSHQVASFPRLAEPAKWFKERFDRIITSVPNFMRPK
YFALVISESYKAARKAAIEQCSDFVTLGHGFTQDLALCAIQMHGQVKSASLHPGHPTPSLAAGLPHFTAGWARCW
GRDVFISLRGLFLTTGNFDSAKKHILAFASTLKHGLIPNLLDSVRNPRYNSRDSPWWMLQNIQDYASFVPDGLAI
LSEPVKRRFPKDDTWVPWDDDRAYADSSTVAEIIQEILQRHADGISFREYNAGPNLDMQMADGGFNIDIKVDWDN
GLIFGGNQWNCGTWMDKMGESTKAGTKGVPGTPRDGAPVEITGLLASTLRWLDAISTKGLFPFKGVQATIKGKQT
FVTYGEWASLIRKHFERCYYVPLDLSEDPAYDIKSSIVNRRGIYKDVYGSGSGREWSDYQLRCNFPMAMAVAPEL
FDEGHALGALKVADEVLRGPLGMKTLDPADMQYRPVYDNSNDSADPSIAKGLNYHNGPEWGWPLGYFLRAYLHFD
KKNRNKTLHYLHHILLKPRSHLENDKWRGLPELTNAGGEYCADSCNTQAWSASTLLDFLDDVHRV*
Coding >Agabi119p4|093830
ATGGCCGAGAACAGACCAGTAGTTTCCATTGCCCCGGACGCCGGTCCCGGGCTTCTCTCCCCAAAAACCCCCGCA
GATAGAGCTCTTGAATTCTTCTCATCCTCAACCCAGTCAGACGCCCCTATTGTAGTCTATGAATTGAGTCTCGAT
CCGGATGGCGGCCCAAACAAAGATTGCCAGTATATCCGCCTACCTCCACCCTATGTTCCCTATATTCTTAGAGTG
TCCTCCGCTGCAGGAACACCTGCTTCCAACAATGGTATATTCAAAACCAACTTTCCTTTAGACGGAGGAGTATTT
GGCAGAAACCGCTATACCCAACGGAAACTCCCTACCGATTATTCCAAGCCCATTCAAGTAGATTTACCGATATCT
CACGCTGGTGCATTTATCTATTGGGTAGAGTATGATGGTGATGATGGACAGCGTATCAAGGGTCGACACGGATAT
TTCAATGTCGATCCAGTCCTTCAAATCAAGAGTCGCACTCCCGTTCTTGATGGCAATCTCAAAGTTTTGCCTCCA
GGTCAAGGTGCAAACATCACAGATAAATACGTCAATCTCCCTCTCGATGGGTTATCGATCTTGACTGTGGTATCG
AAATGGATGGGAACGATGGACCATTGGCGAGACCATTTTGCTGAAGCCAAAGAACGCGGATATACAATGTTACAT
TATACTCCCTTGCAAGAACGTGGAGAAAGCAATAGCCCTTACTCAATTCGGGACCAGATGAAATATGATTCTACA
TTGTTCGTTAAATCACCGGACAATGGGAGTGGGAAGGAGAGAGTAGTTGAAGTTCTCAAACTCGCTCGGGAAGAG
TATGGATTACTCAGTTTGACAGATGTTGTCCTCAACCATACGGCAAATAACAGCCCTTGGTTGGTAGATCATCCC
GAAGCTGGTTTTAGTCCGAAAAACACGCCTCATCTCTCGCCTGCACTCGAACTAGACACCGCCCTGATTGACTTT
TCCGACAAAGTTGCTTCTAGGGGACTCCCATCAGCCATAAACTCTGAAGCGGACCTGCATTGCCTTGTCTCCGCT
CTCGAGGAAGATCTCAAAGCACTCAATCTCTGGCAATACTACGTATTAGACCCATCGCGCGAAAAGAACTCCATC
ATAACCTCGTTGACATCAGGAAAATTCAAACCTTGGACAGGACAAGATGTTCGAGGGAAAACTGATGTCGAATTG
GCAGAGATCCTGCGTTCCCAACAGCTCATCACCGGACTGGGGCAACTGGGGTCTAGATTCGGAGTTCACGTCGAC
AGTGCTGTCAGTGCAGGCCTTATGAAAGCCGCTCTACCAGAAATTCAAGACAATGACGTCCTCGCTGAGGCATGG
ATCAAAGCGGTCGATGTCATCAACGTGCCTTTGTATAGTGAGTGGGAAGAAGACATGCGAGCGGCCCTAGACAAT
ATACGGAATCGAGTTAAATATACGAGGTTGGATCCCAATGGACCCAAATTAAAGGAAATTTCGAAAAAAAATCCC
CTCGTCGAACCCTATTTCACGCGTGTCCTCCCCAAATCGGATACTGATCCATTCACTTATTCATTGGCCAATAAC
GGATGGATATGGAACGCAGACCCCCTTCAGAATTTTGCACTTCTTCCCTCCAAAGCTTATTTACGTCGCGAAGTC
ATCGTATGGGGTGATTGTGTCAAGTTGCGATACGGAAAATCTCCAGAATCGAATCCCTGGTTATGGAGTTACATG
CGAGACTACGTCACATCTCTTGCAGAAACTTTCGATGGATTTAGAATCGACAATTGTCATTCCACACCACTCGAA
GTTGGGACATACATGCTTGACGCGGCAAGGGAAATGCGACCTGACCTTTACGTTTGCGCCGAATTATTCACTGGC
AATGAAGAGACAGATTTGTTGTTTGTTAGAGAACTCGGTATCAACAGTTTGGTTCGAGAGTCTTACAACGGTTGG
GATCCAAAAGAGTTGTCCCGGTTATTGTATCGACATGGAGTTGGGAAACCCATTGGTTCCATGGATGGTGTATGT
ATGACAAGTATGGAGGAGATTGTGAGTCCTACTGGGAAAGGGTTGACTCGACCAGCGCTTGTCACTCCTCTCAAT
GGTTCTGTGCCTCATGCACTACTCTACGACCTCACACACGACAACGAGTCACCGCTGCATAAACGGTCTGCGGAG
GATGCTCTCTCGACAGGTGCGCTGGCAACATTCAGTTATAGTGCGATTGGAAGTGTGAAGGGCTTCGATGATCTG
TATCCCAAACTTTTGAACTTGGTGCAAGAGGATAGAAAATATCGTATTACAGGAACGGGGAAAGGCAGTGGTATT
GCGAAAGTCAAGCGTATTTTGAACGAGTTACATTTGGAAATGGTGTTAGGCCGTTACGAGGAGGGTCATGTTCAT
CAAGAGAACGACTACATTGTCTTACACCGCGTGCAACCTTCTACTCAGAAGGGATATCTACTAGTCGCCCATACT
GCCTTCTCCAAAGGCTCCAAGGATCGAGGTTACATAACACCAATCAAACTTCGCCGGACTCATGCCAAATTCATC
ATGGGAGCTAGCCTGAATATCGAGTCGTATTCCGATAGCAAAGACAAAGAGTTTCTTGATGGTCTCCCGGCAGTT
TTGGAAGAACTACCAGAAGTCATTGCATCCCAAGGCATAGACAACGAAAGTCCCTATTCCGAGATCGTAGTTCCG
GATACATTTCCACCAGGAAGCGTCATGCTTTTCCAAACTCAACTACAGGATTACGACCCTTCTTTAGACGCCTTT
TGCACCTCGGGAGCAGAGAAAGCCTTCCGTGGTCTTGACCTTGTCGACCTCAACATCGTGCTCTACAGGGCGGAG
GGAGAAGAACGAGACGCAACGGACGGAGTATTTGGAGTCTATGATATACCTGACCTAGGAAAGAATGTTTATTGT
GGTCTTGAAGGGTGGATGCACGCTTTGAGGCATATTATGCGTTACAATGACCTTGGGCACCCTCTATGTGGACAT
TTGAGGGAGGGCACCTGGGCCTTGGATTACGTCCACCAACGATTGAGCCATCAAGTCGCGTCTTTCCCTCGCCTT
GCGGAACCAGCGAAATGGTTCAAGGAGCGTTTTGATCGTATAATCACATCCGTTCCCAATTTCATGCGTCCGAAA
TACTTCGCACTCGTCATATCCGAGAGTTACAAAGCCGCGCGCAAGGCAGCTATCGAGCAGTGTTCCGACTTCGTT
ACTTTAGGACATGGGTTCACTCAAGACTTGGCCCTTTGTGCTATTCAGATGCATGGCCAGGTCAAATCTGCTTCC
TTGCATCCTGGCCATCCCACCCCCTCACTTGCCGCTGGGTTGCCTCACTTTACTGCTGGGTGGGCTCGATGTTGG
GGAAGAGACGTTTTCATTTCCCTCCGGGGTTTGTTTTTAACGACAGGCAACTTTGATAGCGCCAAGAAACATATT
CTTGCGTTTGCGTCTACTCTCAAACACGGATTAATACCCAATCTACTGGATTCTGTCAGGAATCCAAGATACAAC
TCGAGAGATTCGCCGTGGTGGATGTTACAGAATATACAGGATTATGCATCTTTTGTACCAGACGGACTCGCCATA
TTATCCGAACCAGTCAAACGTCGTTTCCCCAAGGATGATACGTGGGTACCCTGGGATGACGATCGAGCGTACGCA
GATTCGAGCACAGTTGCAGAGATCATCCAAGAAATATTACAACGTCATGCCGATGGAATTTCCTTCCGGGAATAT
AACGCTGGTCCTAATTTAGATATGCAGATGGCTGATGGGGGTTTCAATATTGACATCAAAGTTGACTGGGACAAT
GGCCTGATCTTCGGAGGAAATCAATGGAACTGTGGGACTTGGATGGATAAAATGGGAGAATCTACCAAGGCTGGC
ACCAAGGGTGTCCCTGGGACCCCGAGAGACGGTGCACCTGTGGAGATAACTGGATTACTTGCCAGTACTCTACGG
TGGTTGGACGCAATTTCAACAAAGGGTCTGTTCCCGTTCAAAGGCGTCCAAGCAACGATCAAGGGTAAACAAACA
TTCGTCACGTACGGAGAGTGGGCGTCTTTGATCAGGAAACATTTTGAAAGGTGTTATTATGTGCCTTTAGACCTC
AGCGAGGATCCCGCCTATGACATCAAATCTTCCATCGTAAACCGGCGTGGTATCTATAAGGACGTCTACGGTTCT
GGTTCTGGTAGAGAATGGTCCGACTACCAATTACGGTGTAATTTCCCGATGGCCATGGCTGTGGCTCCAGAGCTT
TTCGATGAAGGGCATGCGTTGGGCGCTTTAAAGGTTGCGGACGAAGTTCTGCGTGGTCCCTTGGGAATGAAGACG
CTCGATCCTGCTGACATGCAGTACCGACCAGTGTATGACAATTCAAATGACTCAGCGGATCCATCGATTGCCAAG
GGGCTCAATTACCACAATGGTCCAGAGTGGGGTTGGCCCTTAGGATATTTCTTACGTGCTTATCTTCATTTCGAT
AAGAAGAACCGCAACAAGACTTTGCACTACCTTCATCACATATTGCTGAAGCCCAGAAGCCATCTTGAGAACGAT
AAGTGGCGTGGATTACCAGAGCTGACCAATGCTGGTGGCGAGTATTGCGCAGACTCGTGCAATACGCAGGCATGG
AGCGCGAGCACACTGTTAGACTTCCTGGACGATGTGCATCGTGTGTAA
Transcript >Agabi119p4|093830
ATGGCCGAGAACAGACCAGTAGTTTCCATTGCCCCGGACGCCGGTCCCGGGCTTCTCTCCCCAAAAACCCCCGCA
GATAGAGCTCTTGAATTCTTCTCATCCTCAACCCAGTCAGACGCCCCTATTGTAGTCTATGAATTGAGTCTCGAT
CCGGATGGCGGCCCAAACAAAGATTGCCAGTATATCCGCCTACCTCCACCCTATGTTCCCTATATTCTTAGAGTG
TCCTCCGCTGCAGGAACACCTGCTTCCAACAATGGTATATTCAAAACCAACTTTCCTTTAGACGGAGGAGTATTT
GGCAGAAACCGCTATACCCAACGGAAACTCCCTACCGATTATTCCAAGCCCATTCAAGTAGATTTACCGATATCT
CACGCTGGTGCATTTATCTATTGGGTAGAGTATGATGGTGATGATGGACAGCGTATCAAGGGTCGACACGGATAT
TTCAATGTCGATCCAGTCCTTCAAATCAAGAGTCGCACTCCCGTTCTTGATGGCAATCTCAAAGTTTTGCCTCCA
GGTCAAGGTGCAAACATCACAGATAAATACGTCAATCTCCCTCTCGATGGGTTATCGATCTTGACTGTGGTATCG
AAATGGATGGGAACGATGGACCATTGGCGAGACCATTTTGCTGAAGCCAAAGAACGCGGATATACAATGTTACAT
TATACTCCCTTGCAAGAACGTGGAGAAAGCAATAGCCCTTACTCAATTCGGGACCAGATGAAATATGATTCTACA
TTGTTCGTTAAATCACCGGACAATGGGAGTGGGAAGGAGAGAGTAGTTGAAGTTCTCAAACTCGCTCGGGAAGAG
TATGGATTACTCAGTTTGACAGATGTTGTCCTCAACCATACGGCAAATAACAGCCCTTGGTTGGTAGATCATCCC
GAAGCTGGTTTTAGTCCGAAAAACACGCCTCATCTCTCGCCTGCACTCGAACTAGACACCGCCCTGATTGACTTT
TCCGACAAAGTTGCTTCTAGGGGACTCCCATCAGCCATAAACTCTGAAGCGGACCTGCATTGCCTTGTCTCCGCT
CTCGAGGAAGATCTCAAAGCACTCAATCTCTGGCAATACTACGTATTAGACCCATCGCGCGAAAAGAACTCCATC
ATAACCTCGTTGACATCAGGAAAATTCAAACCTTGGACAGGACAAGATGTTCGAGGGAAAACTGATGTCGAATTG
GCAGAGATCCTGCGTTCCCAACAGCTCATCACCGGACTGGGGCAACTGGGGTCTAGATTCGGAGTTCACGTCGAC
AGTGCTGTCAGTGCAGGCCTTATGAAAGCCGCTCTACCAGAAATTCAAGACAATGACGTCCTCGCTGAGGCATGG
ATCAAAGCGGTCGATGTCATCAACGTGCCTTTGTATAGTGAGTGGGAAGAAGACATGCGAGCGGCCCTAGACAAT
ATACGGAATCGAGTTAAATATACGAGGTTGGATCCCAATGGACCCAAATTAAAGGAAATTTCGAAAAAAAATCCC
CTCGTCGAACCCTATTTCACGCGTGTCCTCCCCAAATCGGATACTGATCCATTCACTTATTCATTGGCCAATAAC
GGATGGATATGGAACGCAGACCCCCTTCAGAATTTTGCACTTCTTCCCTCCAAAGCTTATTTACGTCGCGAAGTC
ATCGTATGGGGTGATTGTGTCAAGTTGCGATACGGAAAATCTCCAGAATCGAATCCCTGGTTATGGAGTTACATG
CGAGACTACGTCACATCTCTTGCAGAAACTTTCGATGGATTTAGAATCGACAATTGTCATTCCACACCACTCGAA
GTTGGGACATACATGCTTGACGCGGCAAGGGAAATGCGACCTGACCTTTACGTTTGCGCCGAATTATTCACTGGC
AATGAAGAGACAGATTTGTTGTTTGTTAGAGAACTCGGTATCAACAGTTTGGTTCGAGAGTCTTACAACGGTTGG
GATCCAAAAGAGTTGTCCCGGTTATTGTATCGACATGGAGTTGGGAAACCCATTGGTTCCATGGATGGTGTATGT
ATGACAAGTATGGAGGAGATTGTGAGTCCTACTGGGAAAGGGTTGACTCGACCAGCGCTTGTCACTCCTCTCAAT
GGTTCTGTGCCTCATGCACTACTCTACGACCTCACACACGACAACGAGTCACCGCTGCATAAACGGTCTGCGGAG
GATGCTCTCTCGACAGGTGCGCTGGCAACATTCAGTTATAGTGCGATTGGAAGTGTGAAGGGCTTCGATGATCTG
TATCCCAAACTTTTGAACTTGGTGCAAGAGGATAGAAAATATCGTATTACAGGAACGGGGAAAGGCAGTGGTATT
GCGAAAGTCAAGCGTATTTTGAACGAGTTACATTTGGAAATGGTGTTAGGCCGTTACGAGGAGGGTCATGTTCAT
CAAGAGAACGACTACATTGTCTTACACCGCGTGCAACCTTCTACTCAGAAGGGATATCTACTAGTCGCCCATACT
GCCTTCTCCAAAGGCTCCAAGGATCGAGGTTACATAACACCAATCAAACTTCGCCGGACTCATGCCAAATTCATC
ATGGGAGCTAGCCTGAATATCGAGTCGTATTCCGATAGCAAAGACAAAGAGTTTCTTGATGGTCTCCCGGCAGTT
TTGGAAGAACTACCAGAAGTCATTGCATCCCAAGGCATAGACAACGAAAGTCCCTATTCCGAGATCGTAGTTCCG
GATACATTTCCACCAGGAAGCGTCATGCTTTTCCAAACTCAACTACAGGATTACGACCCTTCTTTAGACGCCTTT
TGCACCTCGGGAGCAGAGAAAGCCTTCCGTGGTCTTGACCTTGTCGACCTCAACATCGTGCTCTACAGGGCGGAG
GGAGAAGAACGAGACGCAACGGACGGAGTATTTGGAGTCTATGATATACCTGACCTAGGAAAGAATGTTTATTGT
GGTCTTGAAGGGTGGATGCACGCTTTGAGGCATATTATGCGTTACAATGACCTTGGGCACCCTCTATGTGGACAT
TTGAGGGAGGGCACCTGGGCCTTGGATTACGTCCACCAACGATTGAGCCATCAAGTCGCGTCTTTCCCTCGCCTT
GCGGAACCAGCGAAATGGTTCAAGGAGCGTTTTGATCGTATAATCACATCCGTTCCCAATTTCATGCGTCCGAAA
TACTTCGCACTCGTCATATCCGAGAGTTACAAAGCCGCGCGCAAGGCAGCTATCGAGCAGTGTTCCGACTTCGTT
ACTTTAGGACATGGGTTCACTCAAGACTTGGCCCTTTGTGCTATTCAGATGCATGGCCAGGTCAAATCTGCTTCC
TTGCATCCTGGCCATCCCACCCCCTCACTTGCCGCTGGGTTGCCTCACTTTACTGCTGGGTGGGCTCGATGTTGG
GGAAGAGACGTTTTCATTTCCCTCCGGGGTTTGTTTTTAACGACAGGCAACTTTGATAGCGCCAAGAAACATATT
CTTGCGTTTGCGTCTACTCTCAAACACGGATTAATACCCAATCTACTGGATTCTGTCAGGAATCCAAGATACAAC
TCGAGAGATTCGCCGTGGTGGATGTTACAGAATATACAGGATTATGCATCTTTTGTACCAGACGGACTCGCCATA
TTATCCGAACCAGTCAAACGTCGTTTCCCCAAGGATGATACGTGGGTACCCTGGGATGACGATCGAGCGTACGCA
GATTCGAGCACAGTTGCAGAGATCATCCAAGAAATATTACAACGTCATGCCGATGGAATTTCCTTCCGGGAATAT
AACGCTGGTCCTAATTTAGATATGCAGATGGCTGATGGGGGTTTCAATATTGACATCAAAGTTGACTGGGACAAT
GGCCTGATCTTCGGAGGAAATCAATGGAACTGTGGGACTTGGATGGATAAAATGGGAGAATCTACCAAGGCTGGC
ACCAAGGGTGTCCCTGGGACCCCGAGAGACGGTGCACCTGTGGAGATAACTGGATTACTTGCCAGTACTCTACGG
TGGTTGGACGCAATTTCAACAAAGGGTCTGTTCCCGTTCAAAGGCGTCCAAGCAACGATCAAGGGTAAACAAACA
TTCGTCACGTACGGAGAGTGGGCGTCTTTGATCAGGAAACATTTTGAAAGGTGTTATTATGTGCCTTTAGACCTC
AGCGAGGATCCCGCCTATGACATCAAATCTTCCATCGTAAACCGGCGTGGTATCTATAAGGACGTCTACGGTTCT
GGTTCTGGTAGAGAATGGTCCGACTACCAATTACGGTGTAATTTCCCGATGGCCATGGCTGTGGCTCCAGAGCTT
TTCGATGAAGGGCATGCGTTGGGCGCTTTAAAGGTTGCGGACGAAGTTCTGCGTGGTCCCTTGGGAATGAAGACG
CTCGATCCTGCTGACATGCAGTACCGACCAGTGTATGACAATTCAAATGACTCAGCGGATCCATCGATTGCCAAG
GGGCTCAATTACCACAATGGTCCAGAGTGGGGTTGGCCCTTAGGATATTTCTTACGTGCTTATCTTCATTTCGAT
AAGAAGAACCGCAACAAGACTTTGCACTACCTTCATCACATATTGCTGAAGCCCAGAAGCCATCTTGAGAACGAT
AAGTGGCGTGGATTACCAGAGCTGACCAATGCTGGTGGCGAGTATTGCGCAGACTCGTGCAATACGCAGGCATGG
AGCGCGAGCACACTGTTAGACTTCCTGGACGATGTGCATCGTGTGTAA
Gene >Agabi119p4|093830
ATGGCCGAGAACAGACCAGTAGTTTCCATTGCCCCGGACGCCGGTCCCGGGCTTCTCTCCCCAAAAACCCCCGCA
GATAGAGCTCTTGAATTCTTCTCATCCTCAACCCAGTCAGACGCCCCTATTGTAGTCTATGAATTGAGTCTCGAT
CCGGATGGCGGCCCAAACAAAGATTGCCAGGTAACATTGAAAATCTGATCCTTCATTTTGCTGATCTCTTCTTTA
GTATATCCGCCTACCTCCACCCTATGTTCCCTATATTCTTAGAGTGTCCTCCGCTGCAGGAACACCTGCTTCCAA
CAATGGTATATTCAAAACCAACTTTCCTTTAGACGGAGGAGTATTTGGCAGAAACCGCTATACCCAACGGAAGTG
CGTCAATTCTTGGAACCGGCGTCTATCTTTTGTACTTAATCTTCATCTTTTAGACTCCCTACCGATTATTCCAAG
CCCATTCAAGTAGATTTACCGATATCTCACGCTGGTGCATTTATCTATTGGGTAGAGTATGATGGTGATGATGGA
CAGCGTATCAAGGGTCGACACGGATATTTCAATGTCGATCCAGTCCTTCAAATCAAGAGTCGCACTCCCGTTCTT
GATGGCAATCTCAAAGTTTTGCCTCCAGGTCAAGGTGCAAACATCACAGATAAATACGTCAATCTCCCTCTCGAT
GGGTTATCGATCTTGACTGTGGTATCGAAATGGATGGGAACGATGGACCATTGGCGAGACCATTTTGCTGAAGCC
AAAGAACGCGGATATACAATGTTACATTATACTCCCTTGCAAGAACGTGGAGAAAGCAATAGCCCTTACTCAATT
CGGGACCAGATGAAATATGATTCTACATTGTTCGTTAAATCACCGGACAATGGGAGTGGGAAGGAGAGAGTAGTT
GAAGTTCTCAAACTCGCTCGGGAAGAGTATGGATTACTCAGTTTGACAGATGTTGTCCTCAACCATACGGCAAAT
AACAGCCCTTGGTTGGTAGATCATCCCGAAGCTGGTGGGTATTATTTGTATACATGCTCAAGAGTTCTGTTTTCA
AATGCTTGCATTTAGGTTTTAGTCCGAAAAACACGCCTCATCTCTCGCCTGCACTCGAACTAGACACCGCCCTGA
TTGACTTTTCCGACAAAGTTGCTTCTAGGGGACTCCCATCAGCCATAAACTCTGAAGCGGACCTGCATTGCCTTG
TCTCCGCTCTCGAGGAAGATCTCAAAGCACTCAATCTCTGGCAATACTACGTATTAGACCCATCGCGCGAAAAGA
ACTCCATCATAACCTCGTTGACATCAGGAAAATTCAAACCTTGGACAGGACAAGATGTTCGAGGGAAAACTGATG
TCGAATTGGCAGAGATCCTGCGTTCCCAACAGCTCATCACCGGACTGGGGCAACTGGGGTCTAGATTCGGAGTTC
ACGTCGACAGTGCTGTCAGTGCAGGCCTTATGAAAGCCGCTCTACCAGAAATTCAAGACAATGACGTCCTCGCTG
AGGCATGGATCAAAGCGGTCGATGTCATCAACGTGCCTTTGTATAGTGAGTGGGAAGAAGACATGCGAGCGGCCC
TAGACAATATACGGAATCGAGTTAAATATACGAGGTTGGATCCCAATGGACCCAAATTAAAGGAAATTTCGAAAA
AGTGAGTGTTGTTCTTATTGTTGCTCTCACTAAACGAGACACGCGTCCTAGAAATCCCCTCGTCGAACCCTATTT
CACGCGTGTCCTCCCCAAATCGGATACTGATCCATTCACTTATTCATTGGCCAATAACGGATGGATATGGAACGC
AGACCCCCTTCAGAATTTTGCACTTCTTCCCTCCAAAGCTTATTTACGTCGCGAAGTCATCGTATGGGGTGATTG
TGTCAAGTTGCGATACGGAAAATCTCCAGAATCGAATCCCTGGTTATGGAGTTACATGCGAGACTACGTCACATC
TCTTGCAGAAACTTTCGATGGATTTAGAATCGACAATTGTCATTCCACACCACTCGAAGTTGGGACATACATGCT
TGACGCGGCAAGGGAAATGCGACCTGACCTTTACGTTTGCGCCGAATTATTCACTGGCAATGAAGAGACAGATTT
GTTGTTTGTTAGAGAACTCGGTATCAACAGTTTGGTTCGAGAGTCTTACAACGGTTGGGATCCAAAAGAGTTGTC
CCGGTTATTGTATCGACATGGAGTTGGGAAACCCATTGGTTCCATGGATGGTGTATGTATGACAAGTATGGAGGA
GATTGTGAGTCCTACTGGGAAAGGGTTGACTCGACCAGCGCTTGTCACTCCTCTCAATGGTTCTGTGCCTCATGC
ACTACTCTACGACCTCACACACGACAACGAGTCACCGCTGCATAAACGGTCTGCGGAGGATGCTCTCTCGACAGG
TGCGCTGGCAACATTCAGTTATAGTGCGATTGGAAGTGTGAAGGGCTTCGATGATCTGTATCCCAAACTTTTGAA
CTTGGTGCAAGAGGATAGAAAATATCGTATTACAGGAACGGGGAAAGGCAGTGGTATTGCGAAAGTCAAGCGTAT
TTTGAACGAGTTACATTTGGAAATGGTGTTAGGCCGTTACGAGGAGGGTCATGTTCATCAAGAGAACGACGTAAG
TGCGCGTTTTTGAGAAAGAAGAGTCATTCGTTGATCTCCTCTCCACAGTACATTGTCTTACACCGCGTGCAACCT
TCTACTCAGAAGGGATATCTACTAGTCGCCCATACTGCCTTCTCCAAAGGCTCCAAGGATCGAGGTTACAGTAAG
TGGCTTATAATTTTCACATGAGCACGTCTCAAAATCTCTTGACAGTAACACCAATCAAACTTCGCCGGACTCATG
CCAAATTCATCATGGGAGCTAGCCTGAATATCGAGTCGTATTCCGATAGCAAAGACAAAGAGTTTCTTGATGGTC
TCCCGGCAGTTTTGGAAGAACTACCAGAAGTCATTGCATCCCAAGGCATAGACAACGAAAGTCCCTATTCCGAGA
TCGTAGTTCCGGATACATTTCCACCAGGAAGCGTCATGCTTTTCCAAACTCAACTACAGGATTACGACCCTTCTT
TAGACGCCTTTTGCACCTCGGGAGCAGAGAAAGCCTTCCGTGGTCTTGACCTTGTCGACCTCAACATCGTGCTCT
ACAGGGCGGAGGGAGAAGAACGAGACGCAACGGACGGAGTATTTGGAGTCTATGATATACCTGACCTAGGAAAGA
ATGTTTATTGTGGTCTTGAAGGGTGGATGCACGCTTTGAGGCATATTATGCGTTACAATGACCTTGGGCACCCTC
TATGTGGACATTTGAGGGAGGGCACCTGGGCCTTGGATTACGTCCACCAACGATTGAGCCAGTAAGTTCCTTGCC
TACGCATTGATTATTTGTTTGCTGATTGTTCTGTTATCCAGTCAAGTCGCGTCTTTCCCTCGCCTTGCGGAACCA
GCGAAATGGTTCAAGGAGCGTTTTGATCGTATAATCACATCCGTTCCCAATTTCATGCGTCCGAAATACTTCGCA
CTCGTCATATCCGAGAGTTACAAAGCCGCGCGCAAGGCAGCTATCGAGCAGTGTTCCGACTTCGTTACTTTAGGA
CATGGGTTCACTCAAGACTTGGCCCTTTGTGCTATTCAGATGCATGGCCAGGTCAAATCTGCTTCCTTGCATCCT
GGCCATCCCACCCCCTCACTTGCCGCTGGGTTGCCTCACTTTACTGCTGGGTGGGCTCGATGTTGGGGAAGAGAC
GTTTTCATTTCCCTCCGGGGTTTGTTTTTAACGACAGGCAACTTTGATAGCGCCAAGAAACATATTCTTGCGTTT
GCGTCTACTCTCAAACACGGATTAATACCCAATCTACTGGATTCTGTCAGGAATCCAAGGTGATTTGTTTCCCTA
TCGCACACTCTTACCTTTCGCTAAAAGTCGTTTATTCAGATACAACTCGAGAGATTCGCCGTGGTGGATGTTACA
GAATATACAGGATTATGCATCTTTTGTACCAGACGGACTCGCCATATTATCCGAACCAGTCAAACGTCGTTTCCC
CAAGGATGATACGTGGGTACCCTGGGATGACGATCGAGCGTACGCAGATTCGAGCACAGTTGCAGAGATCATCCA
AGAAATATTACAACGTCATGCCGATGGAATTTCCTTCCGGGAATATAACGCTGGTCCTAATTTAGATATGCAGAT
GGCTGATGGGGGTTTCAATATTGACATCAAAGTTGACTGGGACAATGGCCTGATCTTCGGAGGAAATCAATGGAA
CTGTGGGACTTGGATGGATAAAATGGGAGAATCTACCAAGGCTGGCACCAAGGGTGTCCCTGGGACCCCGAGAGA
CGGTGCACCTGTGGAGATAACTGGATTACTTGCCAGTACTCTACGGTGGTTGGACGCAATTTCAACAAAGGGTCT
GTTCCCGTTCAAAGGCGTCCAAGCAACGAGTATGTCATTTAATCTTTTCTTTTCGTCTCTACTCACAAGTCTTTT
GGTCTCAAGTCAAGGGTAAACAAACATTCGTCACGTACGGAGAGTGGGCGTCTTTGATCAGGAAACATTTTGAAA
GGTGTTATTATGTGCCTTTAGGTAAGCCACGAGAGCGTTGGTGTTGTCGATCGCTCATGGGTCCTTCGTTGTAGA
CCTCAGCGAGGATCCCGCCTATGACATCAAATCTTCCATCGTAAACCGGCGTGGTATCTATAAGGACGTCTACGG
TTCTGGTTCTGGTAGAGAATGGTCCGACTACCAATTACGGTGTAATTTCCCGATGGCCATGGCTGTGGCTCCAGA
GCTTTTCGATGAAGGGCATGCGTTGGGCGCTTTAAAGGTTGCGGACGAAGTTCTGCGTGGTCCCTTGGGAATGAA
GACGCTCGATCCTGCTGACATGCAGTACCGACCAGTGTATGACAATTCAAATGACTCAGCGGATCCATCGATTGC
CAAGGGGCTCAATTACCACAATGTACGTGCCACTCCCCATTGGCTGGTCTTCTCTCTCATTCATGGTATTTCAGG
GTCCAGAGTGGGGTTGGCCCTTAGGATATTTCTTACGTGCTTATCTTCATTTCGATAAGAAGGCAAGTCCACCGT
CTAGCCGCATCCATTGACAATTAATAAACATCGTTTTAGAACCGCAACAAGACTTTGCACTACCTTCATCACATA
TTGCTGAAGCCCAGAAGCCATCTTGAGAACGATAAGTGGCGTGGATTACCAGAGCTGACCAATGCTGGTGGCGAG
TATTGCGCAGACTCGTGCAATACGCAGGCATGGAGCGCGAGCACACTGTTAGACTTCCTGGACGATGTGCATCGT
GTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail