Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|093750
Gene name
Locationscaffold_06:1406283..1406972
Strand+
Gene length (bp)689
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat 8.6E-23 76 128
PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat 3.9E-15 39 70

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CN71|FIS1_CRYNB Mitochondria fission 1 protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FIS1 PE=3 SV=1 1 154 7.0E-60
sp|P0CN70|FIS1_CRYNJ Mitochondria fission 1 protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FIS1 PE=3 SV=1 1 154 7.0E-60
sp|Q4P7J4|FIS1_USTMA Mitochondria fission 1 protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FIS1 PE=3 SV=1 5 154 3.0E-58
sp|Q2UF96|FIS1_ASPOR Mitochondria fission 1 protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fis1 PE=3 SV=1 1 155 3.0E-57
sp|Q5AZQ5|FIS1_EMENI Mitochondria fission 1 protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fis1 PE=3 SV=1 3 155 5.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CN71|FIS1_CRYNB Mitochondria fission 1 protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FIS1 PE=3 SV=1 1 154 7.0E-60
sp|P0CN70|FIS1_CRYNJ Mitochondria fission 1 protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FIS1 PE=3 SV=1 1 154 7.0E-60
sp|Q4P7J4|FIS1_USTMA Mitochondria fission 1 protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FIS1 PE=3 SV=1 5 154 3.0E-58
sp|Q2UF96|FIS1_ASPOR Mitochondria fission 1 protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fis1 PE=3 SV=1 1 155 3.0E-57
sp|Q5AZQ5|FIS1_EMENI Mitochondria fission 1 protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fis1 PE=3 SV=1 3 155 5.0E-53
sp|Q4X0I8|FIS1_ASPFU Mitochondria fission 1 protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fis1 PE=3 SV=1 1 155 2.0E-51
sp|Q7S8M1|FIS1_NEUCR Mitochondria fission 1 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtp-2 PE=3 SV=1 3 155 8.0E-51
sp|Q6WRS2|FIS1_TUBBO Mitochondria fission 1 protein OS=Tuber borchii GN=FIS1 PE=2 SV=1 1 155 3.0E-50
sp|Q4IBU4|FIS1_GIBZE Mitochondria fission 1 protein OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FIS1 PE=3 SV=1 1 155 9.0E-50
sp|Q2H047|FIS1_CHAGB Mitochondria fission 1 protein OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FIS1 PE=3 SV=1 4 144 2.0E-41
sp|Q6CFJ0|FIS1_YARLI Mitochondria fission 1 protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FIS1 PE=3 SV=2 5 154 8.0E-41
sp|Q6CU37|FIS1_KLULA Mitochondria fission 1 protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FIS1 PE=3 SV=1 5 154 2.0E-34
sp|P40515|FIS1_YEAST Mitochondria fission 1 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FIS1 PE=1 SV=1 6 155 2.0E-31
sp|Q75AI5|FIS1_ASHGO Mitochondria fission 1 protein OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FIS1 PE=3 SV=1 5 127 7.0E-30
sp|Q9USZ8|FIS1_SCHPO Mitochondria fission 1 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fis1 PE=3 SV=1 6 131 3.0E-29
sp|Q6BLG8|FIS1_DEBHA Mitochondria fission 1 protein OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FIS1 PE=3 SV=2 6 151 4.0E-29
sp|Q6FIQ1|FIS1_CANGA Mitochondria fission 1 protein OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FIS1 PE=3 SV=1 5 137 5.0E-26
sp|Q5AFF7|FIS1_CANAL Mitochondria fission 1 protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FIS1 PE=3 SV=2 6 154 2.0E-25
sp|P84817|FIS1_RAT Mitochondrial fission 1 protein OS=Rattus norvegicus GN=Fis1 PE=1 SV=1 15 149 3.0E-24
sp|Q9Y3D6|FIS1_HUMAN Mitochondrial fission 1 protein OS=Homo sapiens GN=FIS1 PE=1 SV=2 15 149 8.0E-24
sp|Q9CQ92|FIS1_MOUSE Mitochondrial fission 1 protein OS=Mus musculus GN=Fis1 PE=1 SV=1 15 149 9.0E-24
sp|Q3T0I5|FIS1_BOVIN Mitochondrial fission 1 protein OS=Bos taurus GN=FIS1 PE=2 SV=1 15 149 7.0E-23
sp|Q94CK3|FIS1B_ARATH Mitochondrial fission 1 protein B OS=Arabidopsis thaliana GN=FIS1B PE=1 SV=1 28 150 5.0E-11
sp|Q9M1J1|FIS1A_ARATH Mitochondrial fission 1 protein A OS=Arabidopsis thaliana GN=FIS1A PE=1 SV=1 45 155 4.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 127 149 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|093750
MPTELPYAADAQMSLSYDELEVLRVQYQKEHAQAHVTIQTKFNYAWGLVKSPKSNEQAEGIELLQEIFRAEPTRR
RECLYYLALGYYKLGKYEEANRFNALLLEKEPSNMQAQSLSHLIDQAVTKEGYIGMALAGGAAALGGILLATVIR
RASRR*
Coding >Agabi119p4|093750
ATGCCTACAGAACTTCCCTATGCCGCAGATGCCCAGATGTCCCTTTCGTATGACGAATTAGAGGTGCTGCGCGTA
CAATACCAGAAGGAACATGCACAGGCCCATGTTACCATTCAGACCAAGTTCAACTATGCCTGGGGCCTTGTGAAG
AGTCCTAAATCCAACGAACAGGCCGAGGGCATCGAGCTACTGCAAGAGATCTTCAGAGCGGAACCCACACGTCGG
CGAGAATGTCTCTATTACCTCGCCCTCGGATATTACAAGTTGGGCAAATATGAAGAAGCTAACCGTTTCAATGCA
CTGTTACTCGAAAAGGAACCCTCAAATATGCAGGCGCAGTCACTATCACATTTGATCGACCAGGCAGTGACAAAA
GAGGGCTATATCGGCATGGCGCTTGCGGGCGGTGCGGCAGCACTAGGCGGCATCCTTCTGGCAACTGTGATACGG
CGAGCATCTCGACGATAA
Transcript >Agabi119p4|093750
ATGCCTACAGAACTTCCCTATGCCGCAGATGCCCAGATGTCCCTTTCGTATGACGAATTAGAGGTGCTGCGCGTA
CAATACCAGAAGGAACATGCACAGGCCCATGTTACCATTCAGACCAAGTTCAACTATGCCTGGGGCCTTGTGAAG
AGTCCTAAATCCAACGAACAGGCCGAGGGCATCGAGCTACTGCAAGAGATCTTCAGAGCGGAACCCACACGTCGG
CGAGAATGTCTCTATTACCTCGCCCTCGGATATTACAAGTTGGGCAAATATGAAGAAGCTAACCGTTTCAATGCA
CTGTTACTCGAAAAGGAACCCTCAAATATGCAGGCGCAGTCACTATCACATTTGATCGACCAGGCAGTGACAAAA
GAGGGCTATATCGGCATGGCGCTTGCGGGCGGTGCGGCAGCACTAGGCGGCATCCTTCTGGCAACTGTGATACGG
CGAGCATCTCGACGATAA
Gene >Agabi119p4|093750
ATGCCTACAGAACTTCCCTATGCCGCAGATGCCCAGATGTCCCTTTCGTATGACGAATTAGAGGTCATTCCCTCT
GCGTGTTCTAGAATTTTCCCTCCTTACCTTTTCACTTTTAGGTGCTGCGCGTACAATACCAGAAGGAACATGCAC
AGGCCCATGTTACCATTCAGACCAAGTTCAACTATGCCTGGGGCCTTGTGAAGAGTCCTAAATCCAACGAACAGG
CCGAGGGCATCGAGCTACTGCAAGGCAGGCGTCTTGTCCCTGCTCAATTGCCTGTATCCTGTCCTCTGACATCAT
AGTTCTCTCAAGAGATCTTCAGAGCGGAACCCACACGTCGGCGAGAATGTCTCTATTACCTCGCCCTCGGATATT
ACAAGTTGGGCAAATATGAAGAAGCTAACCGTTTCAATGGTAGGGGTTCCGTGGTTCCTGTATACTCTCAATAGC
TGAAGCGGCATGTCGGCAGCACTGTTACTCGAAAAGGAACCCTCAAATATGCAGGCGCAGTCACTATCACATTTG
ATCGACCAGGCAGTGACAAAAGGTGTGCTACGTCAAACTTTGTTTTCAACATCGTGTTAACGACATTGGCAGAGG
GCTATATCGGCATGGCGCTTGCGGGCGGTGCGGCAGCACTAGGCGGCATCCTTCTGGCAACTGTGATACGGCGAG
CATCTCGACGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail