Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|093390
Gene name
Locationscaffold_06:1303967..1306712
Strand+
Gene length (bp)2745
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 4.8E-31 209 616
PF07687 M20_dimer Peptidase dimerisation domain 1.1E-11 329 473
PF04389 Peptidase_M28 Peptidase family M28 2.5E-05 194 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 132 620 2.0E-119
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 127 623 3.0E-115
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 110 619 3.0E-107
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 158 620 5.0E-63
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 140 622 6.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 132 620 2.0E-119
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 127 623 3.0E-115
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 110 619 3.0E-107
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 158 620 5.0E-63
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 140 622 6.0E-60
sp|Q8C165|P20D1_MOUSE Probable carboxypeptidase PM20D1 OS=Mus musculus GN=Pm20d1 PE=1 SV=1 140 619 1.0E-57
sp|Q5ZL18|P20D1_CHICK Probable carboxypeptidase PM20D1 OS=Gallus gallus GN=PM20D1 PE=2 SV=1 118 619 2.0E-53
sp|Q08BB2|P2012_DANRE Probable carboxypeptidase PM20D1.2 OS=Danio rerio GN=pm20d1.2 PE=2 SV=1 114 619 3.0E-53
sp|Q55DL1|CBPS1_DICDI Probable carboxypeptidase S-like 1 OS=Dictyostelium discoideum GN=DDB_G0270582 PE=3 SV=1 163 617 4.0E-53
sp|Q08BT9|P20D1_XENTR Probable carboxypeptidase PM20D1 OS=Xenopus tropicalis GN=pm20d1 PE=2 SV=1 133 619 7.0E-51
sp|Q32LT9|P2011_DANRE Probable carboxypeptidase PM20D1.1 OS=Danio rerio GN=pm20d1.1 PE=2 SV=1 120 619 5.0E-47
sp|Q6GTS8|P20D1_HUMAN Probable carboxypeptidase PM20D1 OS=Homo sapiens GN=PM20D1 PE=2 SV=3 140 619 3.0E-45
sp|Q7VRT2|DAPE_BLOFL Succinyl-diaminopimelate desuccinylase OS=Blochmannia floridanus GN=dapE PE=3 SV=1 196 364 2.0E-11
sp|B3H2U3|DAPE_ACTP7 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dapE PE=3 SV=1 208 366 4.0E-11
sp|A3N3G9|DAPE_ACTP2 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dapE PE=3 SV=1 208 366 4.0E-11
sp|Q99SN6|DAPE_STAAN Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain N315) GN=dapE PE=1 SV=1 133 611 5.0E-11
sp|Q6GF48|DAPE_STAAR Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MRSA252) GN=dapE PE=3 SV=1 133 611 1.0E-10
sp|Q8NVL7|DAPE_STAAW Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MW2) GN=dapE PE=3 SV=1 133 611 1.0E-10
sp|Q6G7T6|DAPE_STAAS Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MSSA476) GN=dapE PE=3 SV=1 133 611 1.0E-10
sp|Q7VNB3|DAPE_HAEDU Succinyl-diaminopimelate desuccinylase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dapE PE=3 SV=1 208 370 2.0E-10
sp|Q6AYS7|ACY1A_RAT Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1 174 313 4.0E-10
sp|B0BTF3|DAPE_ACTPJ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dapE PE=3 SV=1 208 366 1.0E-09
sp|B0UT10|DAPE_HISS2 Succinyl-diaminopimelate desuccinylase OS=Histophilus somni (strain 2336) GN=dapE PE=3 SV=1 200 368 2.0E-09
sp|Q9CM22|DAPE_PASMU Succinyl-diaminopimelate desuccinylase OS=Pasteurella multocida (strain Pm70) GN=dapE PE=3 SV=1 208 370 3.0E-09
sp|Q65US9|DAPE_MANSM Succinyl-diaminopimelate desuccinylase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dapE PE=3 SV=1 208 385 3.0E-09
sp|Q931I4|DAPE_STAAM Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapE PE=3 SV=1 133 460 5.0E-09
sp|A1SXF9|DAPE_PSYIN Succinyl-diaminopimelate desuccinylase OS=Psychromonas ingrahamii (strain 37) GN=dapE PE=3 SV=1 198 363 6.0E-09
sp|A9BZY6|DAPE_DELAS Succinyl-diaminopimelate desuccinylase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dapE PE=3 SV=1 206 351 7.0E-09
sp|B8F824|DAPE_HAEPS Succinyl-diaminopimelate desuccinylase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dapE PE=3 SV=1 201 366 1.0E-08
sp|B9MJL1|DAPE_ACIET Succinyl-diaminopimelate desuccinylase OS=Acidovorax ebreus (strain TPSY) GN=dapE PE=3 SV=1 206 372 2.0E-08
sp|A1W7M0|DAPE_ACISJ Succinyl-diaminopimelate desuccinylase OS=Acidovorax sp. (strain JS42) GN=dapE PE=3 SV=1 206 363 3.0E-08
sp|Q0I1X3|DAPE_HAES1 Succinyl-diaminopimelate desuccinylase OS=Haemophilus somnus (strain 129Pt) GN=dapE PE=3 SV=1 200 368 3.0E-08
sp|Q5RFB0|ACY1_PONAB Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2 172 349 4.0E-08
sp|Q8D2S2|DAPE_WIGBR Succinyl-diaminopimelate desuccinylase OS=Wigglesworthia glossinidia brevipalpis GN=dapE PE=3 SV=1 195 297 4.0E-08
sp|Q03154|ACY1_HUMAN Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1 195 349 5.0E-08
sp|Q4FU86|DAPE_PSYA2 Succinyl-diaminopimelate desuccinylase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dapE PE=3 SV=1 195 617 5.0E-08
sp|Q6PTT0|ACY1B_RAT Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1 SV=1 195 313 8.0E-08
sp|Q21WT4|DAPE_RHOFT Succinyl-diaminopimelate desuccinylase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=dapE PE=3 SV=1 206 374 8.0E-08
sp|A5CCZ1|DAPE_ORITB Succinyl-diaminopimelate desuccinylase OS=Orientia tsutsugamushi (strain Boryong) GN=dapE PE=3 SV=1 208 372 1.0E-07
sp|A9ILD7|DAPE_BART1 Succinyl-diaminopimelate desuccinylase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dapE PE=3 SV=1 208 293 2.0E-07
sp|C5CLT2|DAPE_VARPS Succinyl-diaminopimelate desuccinylase OS=Variovorax paradoxus (strain S110) GN=dapE PE=3 SV=1 200 297 2.0E-07
sp|B9JZL9|DAPE_AGRVS Succinyl-diaminopimelate desuccinylase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dapE PE=3 SV=1 208 383 2.0E-07
sp|B3CRZ3|DAPE_ORITI Succinyl-diaminopimelate desuccinylase OS=Orientia tsutsugamushi (strain Ikeda) GN=dapE PE=3 SV=1 208 364 2.0E-07
sp|Q2Y7X4|DAPE_NITMU Succinyl-diaminopimelate desuccinylase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dapE PE=3 SV=1 198 613 2.0E-07
sp|Q6G567|DAPE_BARHE Succinyl-diaminopimelate desuccinylase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dapE PE=3 SV=1 208 293 3.0E-07
sp|Q6G1H9|DAPE_BARQU Succinyl-diaminopimelate desuccinylase OS=Bartonella quintana (strain Toulouse) GN=dapE PE=3 SV=1 204 293 3.0E-07
sp|B2JID9|DAPE_BURP8 Succinyl-diaminopimelate desuccinylase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dapE PE=3 SV=1 204 493 3.0E-07
sp|Q1QDC1|DAPE_PSYCK Succinyl-diaminopimelate desuccinylase OS=Psychrobacter cryohalolentis (strain K5) GN=dapE PE=3 SV=1 208 377 4.0E-07
sp|Q2SX11|DAPE_BURTA Succinyl-diaminopimelate desuccinylase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dapE PE=3 SV=2 179 351 4.0E-07
sp|B2VE50|DAPE_ERWT9 Succinyl-diaminopimelate desuccinylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dapE PE=3 SV=1 196 309 4.0E-07
sp|A5CXE9|DAPE_VESOH Succinyl-diaminopimelate desuccinylase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dapE PE=3 SV=1 183 374 5.0E-07
sp|A5WD56|DAPE_PSYWF Succinyl-diaminopimelate desuccinylase OS=Psychrobacter sp. (strain PRwf-1) GN=dapE PE=3 SV=1 208 309 6.0E-07
sp|B2HY23|DAPE_ACIBC Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ACICU) GN=dapE PE=3 SV=1 198 351 6.0E-07
sp|Q63T00|DAPE_BURPS Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain K96243) GN=dapE PE=3 SV=2 179 351 6.0E-07
sp|A3NAW2|DAPE_BURP6 Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain 668) GN=dapE PE=3 SV=1 179 351 6.0E-07
sp|A3NWP5|DAPE_BURP0 Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain 1106a) GN=dapE PE=3 SV=1 179 351 6.0E-07
sp|Q3JR15|DAPE_BURP1 Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain 1710b) GN=dapE PE=3 SV=2 179 351 6.0E-07
sp|A1V584|DAPE_BURMS Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain SAVP1) GN=dapE PE=3 SV=1 179 351 6.0E-07
sp|Q62JB1|DAPE_BURMA Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain ATCC 23344) GN=dapE PE=3 SV=1 179 351 6.0E-07
sp|A2SB58|DAPE_BURM9 Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain NCTC 10229) GN=dapE PE=3 SV=1 179 351 6.0E-07
sp|A3MKV8|DAPE_BURM7 Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain NCTC 10247) GN=dapE PE=3 SV=1 179 351 6.0E-07
sp|Q1LNH3|DAPE_CUPMC Succinyl-diaminopimelate desuccinylase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dapE PE=3 SV=1 183 374 6.0E-07
sp|A1B5Y2|DAPE_PARDP Succinyl-diaminopimelate desuccinylase OS=Paracoccus denitrificans (strain Pd 1222) GN=dapE PE=3 SV=1 210 615 7.0E-07
sp|Q31G37|DAPE_THICR Succinyl-diaminopimelate desuccinylase OS=Thiomicrospira crunogena (strain XCL-2) GN=dapE PE=3 SV=1 208 367 8.0E-07
sp|A1UUD2|DAPE_BARBK Succinyl-diaminopimelate desuccinylase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dapE PE=3 SV=1 208 293 8.0E-07
sp|B0VRY3|DAPE_ACIBS Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain SDF) GN=dapE PE=3 SV=1 198 351 9.0E-07
sp|B0V4V8|DAPE_ACIBY Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AYE) GN=dapE PE=3 SV=1 198 351 9.0E-07
sp|B7I842|DAPE_ACIB5 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB0057) GN=dapE PE=3 SV=1 198 351 9.0E-07
sp|A3M8H2|DAPE_ACIBT Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dapE PE=3 SV=2 198 351 9.0E-07
sp|B7GXA3|DAPE_ACIB3 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB307-0294) GN=dapE PE=3 SV=1 198 351 1.0E-06
sp|Q5NYT7|DAPE_AROAE Succinyl-diaminopimelate desuccinylase OS=Aromatoleum aromaticum (strain EbN1) GN=dapE PE=3 SV=1 184 283 1.0E-06
sp|A9NCE9|DAPE_COXBR Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dapE PE=3 SV=1 208 363 1.0E-06
sp|Q8XZK5|DAPE_RALSO Succinyl-diaminopimelate desuccinylase OS=Ralstonia solanacearum (strain GMI1000) GN=dapE PE=3 SV=2 206 618 1.0E-06
sp|Q5F812|DAPE_NEIG1 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dapE PE=3 SV=1 208 298 1.0E-06
sp|Q83DN2|DAPE_COXBU Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dapE PE=3 SV=1 208 363 1.0E-06
sp|A9KC82|DAPE_COXBN Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dapE PE=3 SV=1 208 363 1.0E-06
sp|B6J120|DAPE_COXB2 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuG_Q212) GN=dapE PE=3 SV=1 208 363 1.0E-06
sp|B6J929|DAPE_COXB1 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuK_Q154) GN=dapE PE=3 SV=1 208 363 1.0E-06
sp|A9M0W6|DAPE_NEIM0 Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup C (strain 053442) GN=dapE PE=3 SV=1 198 298 1.0E-06
sp|Q9JYL2|DAPE_NEIMB Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=dapE PE=1 SV=1 208 298 1.0E-06
sp|A1ISU7|DAPE_NEIMA Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dapE PE=3 SV=1 198 298 1.0E-06
sp|B4RKY8|DAPE_NEIG2 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=dapE PE=3 SV=2 208 298 1.0E-06
sp|Q6FE14|DAPE_ACIAD Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dapE PE=3 SV=1 206 382 1.0E-06
sp|A1KUW7|DAPE_NEIMF Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dapE PE=3 SV=1 208 298 1.0E-06
sp|Q0ASJ5|DAPE_MARMM Succinyl-diaminopimelate desuccinylase OS=Maricaulis maris (strain MCS10) GN=dapE PE=3 SV=1 195 299 1.0E-06
sp|Q28VJ1|DAPE_JANSC Succinyl-diaminopimelate desuccinylase OS=Jannaschia sp. (strain CCS1) GN=dapE PE=3 SV=1 179 300 2.0E-06
sp|A1K719|DAPE_AZOSB Succinyl-diaminopimelate desuccinylase OS=Azoarcus sp. (strain BH72) GN=dapE PE=3 SV=1 188 351 2.0E-06
sp|A9CKC4|DAPE_AGRFC Succinyl-diaminopimelate desuccinylase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dapE PE=3 SV=1 208 382 2.0E-06
sp|Q13F22|DAPE_RHOPS Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisB5) GN=dapE PE=3 SV=1 208 293 2.0E-06
sp|A4YLC3|DAPE_BRASO Succinyl-diaminopimelate desuccinylase OS=Bradyrhizobium sp. (strain ORS278) GN=dapE PE=3 SV=1 208 285 2.0E-06
sp|A1VN92|DAPE_POLNA Succinyl-diaminopimelate desuccinylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=dapE PE=3 SV=1 204 374 2.0E-06
sp|A1WEL1|DAPE_VEREI Succinyl-diaminopimelate desuccinylase OS=Verminephrobacter eiseniae (strain EF01-2) GN=dapE PE=3 SV=1 205 351 2.0E-06
sp|Q0VQG3|DAPE_ALCBS Succinyl-diaminopimelate desuccinylase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dapE PE=3 SV=1 207 494 2.0E-06
sp|A0K8F6|DAPE_BURCH Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain HI2424) GN=dapE PE=3 SV=1 179 351 3.0E-06
sp|Q1BHJ5|DAPE_BURCA Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain AU 1054) GN=dapE PE=3 SV=1 179 351 3.0E-06
sp|Q47FB0|DAPE_DECAR Succinyl-diaminopimelate desuccinylase OS=Dechloromonas aromatica (strain RCB) GN=dapE PE=3 SV=1 173 298 3.0E-06
sp|B2T5K8|DAPE_BURPP Succinyl-diaminopimelate desuccinylase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dapE PE=3 SV=1 190 493 4.0E-06
sp|A1TQ19|DAPE_ACIAC Succinyl-diaminopimelate desuccinylase OS=Acidovorax citrulli (strain AAC00-1) GN=dapE PE=3 SV=1 208 351 4.0E-06
sp|Q15TS8|DAPE_PSEA6 Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dapE PE=3 SV=1 209 374 4.0E-06
sp|Q39F31|DAPE_BURL3 Succinyl-diaminopimelate desuccinylase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dapE PE=3 SV=1 184 351 4.0E-06
sp|Q058B2|DAPE_BUCCC Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dapE PE=3 SV=1 206 360 5.0E-06
sp|Q5FFA0|DAPE_EHRRG Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Gardel) GN=dapE PE=3 SV=1 195 283 6.0E-06
sp|Q5HC82|DAPE_EHRRW Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Welgevonden) GN=dapE PE=3 SV=1 195 283 6.0E-06
sp|Q12C18|DAPE_POLSJ Succinyl-diaminopimelate desuccinylase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dapE PE=3 SV=1 201 298 6.0E-06
sp|Q1MM75|DAPE_RHIL3 Succinyl-diaminopimelate desuccinylase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dapE PE=3 SV=1 208 293 6.0E-06
sp|Q4QP83|DAPE_HAEI8 Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain 86-028NP) GN=dapE PE=3 SV=1 200 366 6.0E-06
sp|B4ECP3|DAPE_BURCJ Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dapE PE=3 SV=1 179 351 6.0E-06
sp|B5F0L0|DAPE_SALA4 Succinyl-diaminopimelate desuccinylase OS=Salmonella agona (strain SL483) GN=dapE PE=3 SV=1 196 351 6.0E-06
sp|Q0A7H5|DAPE_ALKEH Succinyl-diaminopimelate desuccinylase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dapE PE=3 SV=1 174 365 7.0E-06
sp|A9AHS8|DAPE_BURM1 Succinyl-diaminopimelate desuccinylase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dapE PE=3 SV=1 189 351 7.0E-06
sp|Q4FNF5|DAPE_PELUB Succinyl-diaminopimelate desuccinylase OS=Pelagibacter ubique (strain HTCC1062) GN=dapE PE=3 SV=1 209 363 7.0E-06
sp|A6VMI0|DAPE_ACTSZ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dapE PE=3 SV=1 208 309 7.0E-06
sp|A4JF88|DAPE_BURVG Succinyl-diaminopimelate desuccinylase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dapE PE=3 SV=1 179 351 7.0E-06
sp|A4WD51|DAPE_ENT38 Succinyl-diaminopimelate desuccinylase OS=Enterobacter sp. (strain 638) GN=dapE PE=3 SV=1 196 365 8.0E-06
sp|Q2NS82|DAPE_SODGM Succinyl-diaminopimelate desuccinylase OS=Sodalis glossinidius (strain morsitans) GN=dapE PE=3 SV=1 196 372 8.0E-06
sp|Q3IL20|DAPE_PSEHT Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dapE PE=3 SV=1 199 298 8.0E-06
sp|Q2GHW1|DAPE_EHRCR Succinyl-diaminopimelate desuccinylase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dapE PE=3 SV=1 179 283 8.0E-06
sp|Q98D57|DAPE_RHILO Succinyl-diaminopimelate desuccinylase OS=Rhizobium loti (strain MAFF303099) GN=dapE PE=3 SV=1 200 293 9.0E-06
sp|B1JUG2|DAPE_BURCC Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain MC0-3) GN=dapE PE=3 SV=1 179 351 9.0E-06
sp|Q492F7|DAPE_BLOPB Succinyl-diaminopimelate desuccinylase OS=Blochmannia pennsylvanicus (strain BPEN) GN=dapE PE=3 SV=1 208 365 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|093390
MPLKFLARSWFLPLLSHVEVLRKLTGGSKVAGMGPWSLGGTVGVPVPDDTPEIIPMYYKRRSIFYQLPLNRMLVR
NHLANRNSKRFSTSLSWPSLQVQSEQPLSMEGRHVLFPQRHSQLWANLTATFGSRDYQSKTITWLSEAIQVPTES
WDAMGPVGEDPRWEVLAPFHEYLEKAFPLVYSNLKVTKVNTYGIIYEWKGTSPELKPVLFAAHQDVVPVETNTVD
EWNYPPFSGHFDGEKIWGRGASDDKSGLIGVLVALETLISHGYQPTRSIVLASGFDEEVSGLRGAATLAPVLQDL
YGKNGFAFVIDEGSGFGKEYGTTFAMVGTAEKGYTDVEVKVASAGGHSSLPPDHTSIGILSAMLTHLESNPFKLE
FSRDHPLYGSLQCLATHATNMPHDLRKLIRASTTSDDAMSKLTSTMSKDRSMKNLIGTTQAIDLISGGIKANALP
EQAAAIVNHRISVTSSLKATKDRDVQLLTGLASQFNLSFTAFGEVVARGSEGSLTLGDPFHDGLEPAPITSTDAA
PFQVLSGTIRATFNSHRGLTGPDHIFVTPGTMSGNTDTRYYWDLAPSIFRYNHQNFGDVLIGVPKGIHTVNEYME
ADSFMEMIEFFTMLILNTDESTHL*
Coding >Agabi119p4|093390
ATGCCTCTGAAGTTCCTAGCTCGTTCCTGGTTTCTCCCTCTCCTATCGCATGTGGAGGTTCTACGGAAATTGACT
GGTGGGTCAAAGGTAGCAGGGATGGGTCCGTGGAGCCTTGGTGGAACTGTGGGCGTCCCGGTCCCGGATGATACC
CCTGAGATAATACCCATGTACTATAAAAGACGCTCGATTTTCTACCAGTTGCCTCTGAACCGCATGCTTGTCCGA
AACCATCTCGCAAATCGAAATTCAAAGCGCTTCTCCACGTCCTTATCCTGGCCCTCGTTGCAGGTGCAATCGGAA
CAGCCGCTTTCCATGGAGGGACGTCATGTACTTTTCCCCCAAAGACACAGTCAACTATGGGCCAATTTGACTGCA
ACTTTCGGTTCGCGTGACTACCAGTCAAAGACGATCACCTGGCTAAGCGAAGCCATCCAAGTCCCAACGGAATCC
TGGGATGCGATGGGCCCGGTTGGCGAGGATCCCAGGTGGGAAGTATTAGCACCCTTCCATGAATACCTTGAGAAG
GCATTTCCTTTGGTGTATTCTAACCTCAAGGTGACCAAAGTCAACACGTATGGTATAATCTACGAGTGGAAGGGT
ACATCTCCCGAACTGAAACCTGTCCTATTCGCTGCCCATCAAGACGTCGTTCCGGTGGAAACAAACACGGTCGAT
GAGTGGAATTATCCGCCCTTCTCTGGTCACTTCGATGGCGAAAAAATCTGGGGTCGGGGAGCATCCGATGATAAA
TCTGGCCTCATTGGGGTACTCGTTGCTCTCGAAACACTTATCTCTCATGGATATCAGCCAACTCGAAGCATTGTC
CTTGCATCTGGTTTCGACGAAGAAGTCAGTGGACTGAGGGGTGCTGCTACTTTGGCCCCTGTTCTTCAAGATCTC
TACGGGAAAAATGGATTTGCCTTCGTGATTGATGAAGGATCTGGCTTCGGAAAGGAATATGGCACTACTTTTGCG
ATGGTAGGCACTGCGGAGAAGGGATATACCGATGTCGAAGTCAAGGTAGCTAGCGCTGGCGGTCATTCCAGCTTG
CCACCGGATCATACGTCAATCGGTATACTTTCGGCAATGTTAACACATTTGGAGTCAAACCCTTTCAAACTTGAA
TTTAGTCGGGACCATCCGTTATATGGATCTTTACAGTGCCTTGCTACGCATGCAACGAACATGCCACATGACCTT
CGGAAGCTGATCAGAGCCTCGACAACTTCCGATGATGCTATGAGCAAGCTGACTAGCACAATGTCCAAGGATCGC
TCGATGAAGAATTTGATTGGTACGACCCAGGCCATCGATTTGATCAGTGGAGGCATCAAAGCAAATGCACTACCA
GAACAAGCAGCAGCGATTGTCAACCATCGCATTTCTGTGACGAGCTCCCTTAAAGCCACCAAAGACAGAGACGTC
CAACTTCTAACGGGTTTAGCAAGCCAATTTAACCTCTCGTTTACTGCTTTCGGTGAAGTTGTCGCGAGAGGGTCC
GAAGGCAGCCTTACCCTTGGAGACCCTTTCCACGACGGACTAGAACCGGCTCCGATAACGTCCACAGATGCCGCA
CCTTTTCAAGTGCTCTCCGGAACCATCAGAGCGACGTTTAACTCACACCGTGGTCTCACAGGCCCTGACCATATC
TTTGTGACTCCAGGGACGATGTCAGGAAATACCGACACCCGTTATTATTGGGACCTTGCACCCTCCATCTTCCGT
TATAATCACCAAAACTTCGGTGACGTGCTTATTGGAGTCCCGAAAGGCATTCACACTGTCAACGAATATATGGAA
GCCGACTCCTTCATGGAAATGATTGAATTCTTCACGATGCTCATTCTCAACACTGACGAGTCTACACATTTGTAA
Transcript >Agabi119p4|093390
ATGCCTCTGAAGTTCCTAGCTCGTTCCTGGTTTCTCCCTCTCCTATCGCATGTGGAGGTTCTACGGAAATTGACT
GGTGGGTCAAAGGTAGCAGGGATGGGTCCGTGGAGCCTTGGTGGAACTGTGGGCGTCCCGGTCCCGGATGATACC
CCTGAGATAATACCCATGTACTATAAAAGACGCTCGATTTTCTACCAGTTGCCTCTGAACCGCATGCTTGTCCGA
AACCATCTCGCAAATCGAAATTCAAAGCGCTTCTCCACGTCCTTATCCTGGCCCTCGTTGCAGGTGCAATCGGAA
CAGCCGCTTTCCATGGAGGGACGTCATGTACTTTTCCCCCAAAGACACAGTCAACTATGGGCCAATTTGACTGCA
ACTTTCGGTTCGCGTGACTACCAGTCAAAGACGATCACCTGGCTAAGCGAAGCCATCCAAGTCCCAACGGAATCC
TGGGATGCGATGGGCCCGGTTGGCGAGGATCCCAGGTGGGAAGTATTAGCACCCTTCCATGAATACCTTGAGAAG
GCATTTCCTTTGGTGTATTCTAACCTCAAGGTGACCAAAGTCAACACGTATGGTATAATCTACGAGTGGAAGGGT
ACATCTCCCGAACTGAAACCTGTCCTATTCGCTGCCCATCAAGACGTCGTTCCGGTGGAAACAAACACGGTCGAT
GAGTGGAATTATCCGCCCTTCTCTGGTCACTTCGATGGCGAAAAAATCTGGGGTCGGGGAGCATCCGATGATAAA
TCTGGCCTCATTGGGGTACTCGTTGCTCTCGAAACACTTATCTCTCATGGATATCAGCCAACTCGAAGCATTGTC
CTTGCATCTGGTTTCGACGAAGAAGTCAGTGGACTGAGGGGTGCTGCTACTTTGGCCCCTGTTCTTCAAGATCTC
TACGGGAAAAATGGATTTGCCTTCGTGATTGATGAAGGATCTGGCTTCGGAAAGGAATATGGCACTACTTTTGCG
ATGGTAGGCACTGCGGAGAAGGGATATACCGATGTCGAAGTCAAGGTAGCTAGCGCTGGCGGTCATTCCAGCTTG
CCACCGGATCATACGTCAATCGGTATACTTTCGGCAATGTTAACACATTTGGAGTCAAACCCTTTCAAACTTGAA
TTTAGTCGGGACCATCCGTTATATGGATCTTTACAGTGCCTTGCTACGCATGCAACGAACATGCCACATGACCTT
CGGAAGCTGATCAGAGCCTCGACAACTTCCGATGATGCTATGAGCAAGCTGACTAGCACAATGTCCAAGGATCGC
TCGATGAAGAATTTGATTGGTACGACCCAGGCCATCGATTTGATCAGTGGAGGCATCAAAGCAAATGCACTACCA
GAACAAGCAGCAGCGATTGTCAACCATCGCATTTCTGTGACGAGCTCCCTTAAAGCCACCAAAGACAGAGACGTC
CAACTTCTAACGGGTTTAGCAAGCCAATTTAACCTCTCGTTTACTGCTTTCGGTGAAGTTGTCGCGAGAGGGTCC
GAAGGCAGCCTTACCCTTGGAGACCCTTTCCACGACGGACTAGAACCGGCTCCGATAACGTCCACAGATGCCGCA
CCTTTTCAAGTGCTCTCCGGAACCATCAGAGCGACGTTTAACTCACACCGTGGTCTCACAGGCCCTGACCATATC
TTTGTGACTCCAGGGACGATGTCAGGAAATACCGACACCCGTTATTATTGGGACCTTGCACCCTCCATCTTCCGT
TATAATCACCAAAACTTCGGTGACGTGCTTATTGGAGTCCCGAAAGGCATTCACACTGTCAACGAATATATGGAA
GCCGACTCCTTCATGGAAATGATTGAATTCTTCACGATGCTCATTCTCAACACTGACGAGTCTACACATTTGTAA
Gene >Agabi119p4|093390
ATGCCTCTGAAGTTCCTAGCTCGTTCCTGGTTTCTCCCTCTCCTATCGCATGTGGAGGTTCTACGGAAATTGACT
GGTGGTTAGCCATACAGGCTCTTGCGTATTTCGTGTGGCCAGAATACAACTGACCATTCGTAGGGTCAAAGGTAG
CAGGGATGGGTCCGTGGAGCCTTGGTGGAACTGTGGGGTCATTATCAGGCATCTCAGGGTAAGCACTCGTGGGTA
GCGGACGGGGAAGTGTAGCGTCCCGGTCCCGGATGATACCCCTGAGATAATACCCATGTACTATGTAAGAAGCTA
TTTCCTGGATTCTTCTTTTTGGTCTCATACTTTTACGACCATGCAAGAAAAGACGCTCGATTTTCTACCAGTTGC
CTCTGAACCGCATGCTTGTCCGAAACCATCTCGCAAATCGAAATTCAAAGCGCTTCTCCACGTCCTTATCCTGGC
CCTCGTTGCAGGTGCAATCGGAACAGCCGCTTTCCATGGAGGGACGTCGTGTGGAAGGAAAGATTCGTCTATTGC
TGAAACCTTTGATGGCACATGTGGTCAAGTAGATGTACTTTTCCCCCAAAGACACAGTCAACTATGGGCCAATTT
GACTGCAACTTTCGGTTCGCGTGACTACCAGTCAAAGACGATCACCTGGCTAAGCGAAGCCATCCAAGTCCCGTG
AGTTTTGGTGTAGTCTGGTCCATAAGAAATGAATCTAACATAGCATATTCAGAACGGAATCCTGGGATGCGATGG
GCCCGGTTGGCGAGGATCCCAGGTGGGAAGTATTAGCACCCTTCCATGAATACCTTGAGAAGGCATTTCCTTTGG
TGTACGTTCATTCTGACTCCTAATTTGTTCTTTTTGATCATCCGCTCCCAGGTATTCTAACCTCAAGGTGACCAA
AGTCAACACGTATGGTATAATCTACGAGTGGAAGGGTACATCTCCCGAACTGAAACCTGTCCTATTCGCTGCCCA
TCAAGGTATGTCGTAAAGTCTGGGGGCTACGTTCTTATTGAACTCGAAAACCCGTAGACGTCGTTCCGGTGGAAA
CAAACACGGTCGATGAGTGGAATTATCCGCCCTTCTCTGGTCACTTCGATGGTACTGTTAATTTTTATCGTGACT
TGACGCAAAGTGGTTGATTTCCCATCTTCGCAGGCGAAAAAATCTGGGGTCGGGGAGCATCCGATGATAAATCTG
GCCTCATTGGGGTACTGTAAGTGGTTTAAAGTTCCACAATACCGCCGTCTATAATTTCGGCAGCGTTGCTCTCGA
AACACTTATCTCTCATGGATATCAGCCAACTCGAAGCATTGTCCTTGCATCTGGTTTCGACGAAGAAGTCAGTGG
ACTGAGGGTACGAATTTTGGGTAGAAGCTCTTGGAGTCGAGTCGAATCCTGATAATTCACTAGGGTGCTGCTACT
TTGGCCCCTGTTCTTCAAGATCTCTACGGGAAAAATGGATTTGCCTTCGTGATTGATGAAGGATGTGAGTTCAAT
CAAAGTCATCTTGACGGAAGTAGATACTGAGATATTGCGTAGCTGGCTTCGGAAAGGAATATGGCACTACTTTTG
CGATGGTAGGCACTGCGGAGAAGGGATATACCGATGTCGAAGTCAAGGTAGCTAGCGCTGGCGGTCATTCCAGCT
TGCCACCGGATCATACGGTACATCTCTCTCACCCTCGGTCGGCCGATGTCTTGAGCTCAATCGTGCTTACAGTCA
ATCGGTATACTTTCGGCAATGTTAACACATTTGGAGTCAAACCCTTTCAAACTTGAATTTGTCGGTAAAGTCGAT
GTAAGCGATGAGCTGCTCGCTGACATGCTTTCTCTCAGAGTCGGGACCATCCGTTATATGGATCTTTACAGTGCC
TTGCTACGCATGCAACGAACATGCCACATGACCTTCGGAAGCTGATCAGAGCCTCGACAACTTCCGATGATGCTA
TGAGCAAGCTGACTAGCACAATGTCCAAGGATCGCTCGATGAAGAATTTGATTGGTACGACCCAGGCCATCGATT
TGATCAGTGGAGGCATCAAAGCAAATGCACTACCAGAACAAGCAGCAGCGATTGTCAACCATCGCATTTCTGTGA
CGAGGTTGGGGTCTTTCCACGATATACGAGAGGTTACTTATTGTTTGCCTGTTGTTTGCAGCTCCCTTAAAGCCA
CCAAAGACAGAGACGTCCAACTTCTAACGGGTTTAGCAAGCCAATTTAACCTCTCGTTTACTGCTTTCGGTGAAG
TTGTCGCGAGAGGGTCCGAAGGCAGCCTTACCCTTGGAGACCCTTTCCACGACGGACTAGAACCGGCTCCGATAA
CGTCCACAGATGCCGCACCTTTTCAAGTGCTCTCCGGAACCATCAGAGCGACGTTTAACTCACACCGTGGTCTCA
CAGGCCCTGACCATATCTTTGTGACTCCAGGGACGATGTCAGGAAATACCGGTGAGTGGCGAATCATCTTCAAGG
GATTGAGGCTGATATGAAGGAACATCAGACACCCGTTATTATTGGGACCTTGCACCCTCCATCTTCCGTTATAAT
CACCAAAACTTCGGTGACGTGCTTATTGGAGTCCCGAAAGGCATTCACACTGTCAACGAATGTCAGTATGCTTTC
TAATTTGACATTTATTAACGAACTCAAATTCTCTCAGATATGGAAGCCGACTCCTTCATGGAAATGATTGAATTC
TTCACGATGCTCATTCTCAACACTGACGAGTCTACACATTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail