Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|093030
Gene name
Locationscaffold_06:1227645..1230085
Strand-
Gene length (bp)2440
Transcript length (bp)2019
Coding sequence length (bp)2019
Protein length (aa) 673

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 4.3E-07 469 512
PF00018 SH3_1 SH3 domain 2.0E-07 570 616
PF07647 SAM_2 SAM domain (Sterile alpha motif) 4.7E-11 12 74
PF00536 SAM_1 SAM domain (Sterile alpha motif) 1.5E-10 12 74
PF00788 RA Ras association (RalGDS/AF-6) domain 3.7E-06 243 320

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25344|STE50_YEAST Protein STE50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE50 PE=1 SV=1 210 323 3.0E-09

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0007165 signal transduction Yes
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|093030
MDNDLASRPILEWDPADVHRWLSSIGFSQYEHPLKENSVGGDVFVMLNSETLRELGVPTIGQRLAILKAIYQLKI
ANNIPIDEDHYIPPSEACDLPESMTLDKLYSILNTQVNRLHALEDDNRHLHQLVCSFAEDLGAIKASLTRSDEPN
ELRRQPSFKWGQFVQPQRSPTKQDAVESPHPSPQRLEHEMPYSRSTATPVFPSAPQATVTPEKSRQATQPPSVTD
SPNPNQSLRSQRQESSDNLKSFKVSLEDPTWKVLPAALKKYRINNDTWKNYAMFICYGPSGNRIERCLSYDEKPL
LLFQKLKDSKKNPVFMLKHIKDIRSPIAVAQQKHAARRASSMVSNDTVPTQGHTKSTSDSKSNHRPPRLEVSDLS
TPSGPLSTTPTPRPGWQEGSLPSPLIGQDKSDDVGAPSTSTSSRTLGSTTTDATLNVPNATVSRPESKASEIPHG
GHSSPVAIPSPSGSVSYAVAIYPYMAEQEDEFDVVVGDTFIILSRSRGWWIVQQDPTGSGVVDTDIVKQGWVPAG
CLLETNVPVASAIAEATAAKGTASGDASKTPILPLSIISTSFPGVALMDYRKKGDEELDLVEGEQLRVFKRYNHW
SYAVKEQGGDRGWVPSWFIGKVSSHLGNSPNTPASGTTGHAPSSSTSNFEDMTQTQVSPMSSAFPPVQPAKS*
Coding >Agabi119p4|093030
ATGGACAACGATCTCGCCAGTCGACCCATCCTCGAGTGGGACCCAGCAGACGTCCACAGATGGCTTTCCAGCATC
GGTTTCTCCCAGTACGAGCACCCGCTCAAGGAAAACAGCGTCGGCGGCGACGTTTTTGTCATGCTAAACAGTGAA
ACCCTCAGGGAACTCGGCGTACCCACAATTGGCCAGAGGCTGGCTATTCTCAAGGCCATATACCAGCTCAAGATC
GCAAACAATATCCCGATAGACGAAGACCACTATATACCTCCATCCGAAGCCTGTGATCTTCCCGAGAGCATGACG
CTGGACAAATTGTATTCTATTTTGAACACACAAGTAAACCGACTCCATGCCCTCGAAGATGATAATCGTCACTTG
CACCAACTTGTCTGCTCCTTTGCAGAAGATTTGGGCGCCATCAAAGCATCGTTGACTCGTAGTGATGAGCCCAAT
GAACTTCGGCGACAGCCATCCTTTAAATGGGGTCAATTCGTCCAGCCTCAGCGGTCGCCAACGAAACAAGACGCA
GTCGAATCGCCTCATCCATCCCCTCAAAGACTGGAACACGAGATGCCCTACAGTCGTTCCACTGCCACACCCGTT
TTTCCCTCCGCACCACAGGCTACAGTGACACCAGAGAAATCACGTCAAGCAACCCAACCTCCTTCAGTGACTGAT
TCACCTAACCCCAACCAATCACTCCGAAGCCAACGTCAGGAGAGTTCTGACAATTTGAAAAGCTTCAAAGTTAGT
CTGGAAGATCCAACATGGAAAGTACTTCCGGCTGCATTAAAGAAGTACCGTATCAACAATGACACATGGAAGAAC
TATGCAATGTTCATTTGCTATGGGCCGTCGGGTAACCGCATTGAACGATGTTTGAGTTACGACGAAAAACCGCTC
CTTTTGTTTCAAAAGCTGAAGGACTCAAAGAAAAACCCTGTTTTCATGCTTAAACACATCAAAGATATTCGCTCT
CCAATTGCTGTTGCCCAACAAAAACACGCAGCCCGTAGAGCCTCTTCCATGGTATCTAATGACACCGTGCCAACT
CAGGGCCATACTAAATCGACCTCTGATTCGAAATCTAACCATCGGCCGCCAAGACTAGAGGTCTCCGACCTTTCT
ACACCTTCCGGACCATTATCGACAACTCCCACGCCTCGGCCTGGATGGCAAGAAGGGAGTCTTCCTTCACCGCTA
ATTGGACAAGACAAGAGCGATGATGTAGGAGCGCCTTCCACCTCCACCAGTTCACGCACTTTGGGATCAACGACC
ACTGATGCCACGTTGAACGTCCCAAATGCAACGGTATCGAGACCCGAGTCAAAGGCCAGTGAAATTCCACATGGT
GGTCATTCGAGCCCAGTTGCCATACCATCACCCAGTGGCAGCGTATCGTATGCTGTCGCTATCTATCCCTATATG
GCAGAACAGGAAGACGAGTTTGATGTAGTGGTTGGTGACACTTTTATCATCCTTTCACGATCAAGAGGTTGGTGG
ATCGTACAACAAGATCCGACAGGATCCGGAGTAGTGGATACAGATATAGTTAAGCAAGGCTGGGTGCCAGCGGGT
TGTCTACTCGAGACGAATGTCCCTGTAGCTTCAGCGATTGCCGAAGCAACTGCCGCCAAGGGAACTGCATCTGGT
GATGCTTCCAAGACTCCGATACTCCCTTTAAGCATCATATCAACAAGTTTCCCCGGTGTCGCGCTGATGGACTAT
AGAAAAAAAGGGGATGAGGAACTAGACCTAGTGGAGGGGGAACAATTAAGGGTGTTTAAACGATATAACCACTGG
TCATATGCTGTGAAAGAGCAGGGCGGTGATAGAGGATGGGTACCGTCTTGGTTTATCGGCAAAGTCAGCAGCCAT
CTTGGAAATTCGCCTAACACTCCAGCATCTGGTACGACGGGACATGCACCATCATCGTCCACTTCCAACTTTGAA
GATATGACACAAACCCAAGTATCGCCCATGTCTTCTGCTTTTCCACCTGTACAGCCCGCAAAGTCATAA
Transcript >Agabi119p4|093030
ATGGACAACGATCTCGCCAGTCGACCCATCCTCGAGTGGGACCCAGCAGACGTCCACAGATGGCTTTCCAGCATC
GGTTTCTCCCAGTACGAGCACCCGCTCAAGGAAAACAGCGTCGGCGGCGACGTTTTTGTCATGCTAAACAGTGAA
ACCCTCAGGGAACTCGGCGTACCCACAATTGGCCAGAGGCTGGCTATTCTCAAGGCCATATACCAGCTCAAGATC
GCAAACAATATCCCGATAGACGAAGACCACTATATACCTCCATCCGAAGCCTGTGATCTTCCCGAGAGCATGACG
CTGGACAAATTGTATTCTATTTTGAACACACAAGTAAACCGACTCCATGCCCTCGAAGATGATAATCGTCACTTG
CACCAACTTGTCTGCTCCTTTGCAGAAGATTTGGGCGCCATCAAAGCATCGTTGACTCGTAGTGATGAGCCCAAT
GAACTTCGGCGACAGCCATCCTTTAAATGGGGTCAATTCGTCCAGCCTCAGCGGTCGCCAACGAAACAAGACGCA
GTCGAATCGCCTCATCCATCCCCTCAAAGACTGGAACACGAGATGCCCTACAGTCGTTCCACTGCCACACCCGTT
TTTCCCTCCGCACCACAGGCTACAGTGACACCAGAGAAATCACGTCAAGCAACCCAACCTCCTTCAGTGACTGAT
TCACCTAACCCCAACCAATCACTCCGAAGCCAACGTCAGGAGAGTTCTGACAATTTGAAAAGCTTCAAAGTTAGT
CTGGAAGATCCAACATGGAAAGTACTTCCGGCTGCATTAAAGAAGTACCGTATCAACAATGACACATGGAAGAAC
TATGCAATGTTCATTTGCTATGGGCCGTCGGGTAACCGCATTGAACGATGTTTGAGTTACGACGAAAAACCGCTC
CTTTTGTTTCAAAAGCTGAAGGACTCAAAGAAAAACCCTGTTTTCATGCTTAAACACATCAAAGATATTCGCTCT
CCAATTGCTGTTGCCCAACAAAAACACGCAGCCCGTAGAGCCTCTTCCATGGTATCTAATGACACCGTGCCAACT
CAGGGCCATACTAAATCGACCTCTGATTCGAAATCTAACCATCGGCCGCCAAGACTAGAGGTCTCCGACCTTTCT
ACACCTTCCGGACCATTATCGACAACTCCCACGCCTCGGCCTGGATGGCAAGAAGGGAGTCTTCCTTCACCGCTA
ATTGGACAAGACAAGAGCGATGATGTAGGAGCGCCTTCCACCTCCACCAGTTCACGCACTTTGGGATCAACGACC
ACTGATGCCACGTTGAACGTCCCAAATGCAACGGTATCGAGACCCGAGTCAAAGGCCAGTGAAATTCCACATGGT
GGTCATTCGAGCCCAGTTGCCATACCATCACCCAGTGGCAGCGTATCGTATGCTGTCGCTATCTATCCCTATATG
GCAGAACAGGAAGACGAGTTTGATGTAGTGGTTGGTGACACTTTTATCATCCTTTCACGATCAAGAGGTTGGTGG
ATCGTACAACAAGATCCGACAGGATCCGGAGTAGTGGATACAGATATAGTTAAGCAAGGCTGGGTGCCAGCGGGT
TGTCTACTCGAGACGAATGTCCCTGTAGCTTCAGCGATTGCCGAAGCAACTGCCGCCAAGGGAACTGCATCTGGT
GATGCTTCCAAGACTCCGATACTCCCTTTAAGCATCATATCAACAAGTTTCCCCGGTGTCGCGCTGATGGACTAT
AGAAAAAAAGGGGATGAGGAACTAGACCTAGTGGAGGGGGAACAATTAAGGGTGTTTAAACGATATAACCACTGG
TCATATGCTGTGAAAGAGCAGGGCGGTGATAGAGGATGGGTACCGTCTTGGTTTATCGGCAAAGTCAGCAGCCAT
CTTGGAAATTCGCCTAACACTCCAGCATCTGGTACGACGGGACATGCACCATCATCGTCCACTTCCAACTTTGAA
GATATGACACAAACCCAAGTATCGCCCATGTCTTCTGCTTTTCCACCTGTACAGCCCGCAAAGTCATAA
Gene >Agabi119p4|093030
ATGGACAACGATCTCGCCAGTCGACCCATCCTCGAGTGGGACCCAGCAGACGTCCACAGATGGCTTTCCAGCATC
GGTTTCTCCCAGTACGAGCACCCGCTCAAGGGTGTGTCTGGCTTCCCTGTCGAACTGCGGCCATACTGACGCGCC
CCAGAAAACAGCGTCGGCGGCGACGTTTTTGTCATGCTAAACAGTGAAACCCTCAGGGAACTCGGCGTACCCACA
ATTGGCCAGAGGCTGGCTATTCTCAAGGCCATATACCAGCTCAAGATCGCAAACAATATCCCGATAGACGAAGAC
CACTATATACCTCCATGTGAGCTTGGAAACAGCGTCCAGCCAGTGCTCATCGAACCCTGTGTTTTCTGACAGCCG
AAGCCTGTGATCTTCCCGAGAGCATGACGCTGGACAAATTGTATTCTATTTTGAACACACAAGGTAGCACAATAT
TATGCCATCGCTATTTTTCGAAAGTCGTTGAATTTTATTGGCATCGTAGTAAACCGACTCCATGCCCTCGAAGAT
GATAATCGTCACTTGCACCAACTTGTCTGCTCCTTTGCAGAAGATTTGGGCGCCATCAAAGCATCGTTGACTCGT
AGTGTATGTGCTGTGCCAGTTACCATCTTGAATCCACTTTTTGATCCCCCTTCTAGGATGAGCCCAATGAACTTC
GGCGACAGCCATCCTTTAAATGGGGTCAATTCGTCCAGCCTCAGCGGTCGCCAACGAAACAAGACGCAGTCGAAT
CGCCTCATCCATCCCCTCAAAGACTGGAACACGAGATGCCCTACAGTCGTTCCACTGCCACACCCGTTTTTCCCT
CCGCACCACAGGCTACAGTGACACCAGAGAAATCACGTCAAGCAACCCAACCTCCTTCAGTGACTGATTCACCTA
ACCCCAACCAATCACTCCGAAGCCAACGTCAGGAGAGTTCTGACAATTTGAAAAGCTTCAAAGTTAGTCTGGAAG
ATCCAACATGGAAAGTACTTCCGGCTGCATTAAAGAAGTACCGTATCAACAATGACACATGGAAGAACTATGCAA
TGTTCATTTGCTATGGGCCGTCGGGTACGGTTAGTTTTATAACCTGATAACCGCGCATTAAATCTTATATAGGTA
ACCGCATTGAACGATGTTTGAGTTACGACGAAAAACCGCTCCTTTTGTTTCAAAAGCTGAAGGACTCAAAGAAAA
ACCCTGTTTTCATGCTTAAACACATCAAAGATATTCGCTCTCCAATTGCTGTTGCCCAACAAAAACACGCAGCCC
GTAGAGCCTCTTCCATGGTATCTAATGACACCGTGCCAACTCAGGGCCATACTAAATCGACCTCTGATTCGAAAT
CTAACCATCGGCCGCCAAGACTAGAGGTCTCCGACCTTTCTACACCTTCCGGACCATTATCGACAACTCCCACGC
CTCGGCCTGGATGGCAAGAAGGGAGTCTTCCTTCACCGCTAATTGGACAAGACAAGAGCGATGATGTAGGAGCGC
CTTCCACCTCCACCAGTTCACGCACTTTGGGATCAACGACCACTGATGCCACGTTGAACGTCCCAAATGCAACGG
TATCGAGACCCGAGTCAAAGGCCAGTGAAATTCCACATGGTGGTCATTCGAGCCCAGTTGCCATACCATCACCCA
GTGGCAGCGTATCGTATGCTGTCGCTATCTATCCCTATATGGCAGAACAGGAAGACGAGTTTGATGTAGTGGTGT
AAGTTGCTGTCTGCTCCTTTCCAGCTCCTCAATTGATTTTTCTTCAGTGGTGACACTTTTATCATCCTTTCACGA
TCAAGAGGTTGGTGGATCGTACAACAAGATCCGACAGGATCCGGAGTAGTGGATACAGATATAGTTAAGCAAGGC
TGGGTGCCAGCGGGTTGTCTACTCGAGACGAATGTCCCTGTAGCTTCAGCGATTGCCGAAGCAACTGCCGCCAAG
GGAACTGCATCTGGTGATGCTTCCAAGACTCCGATACTCCCTTTAAGCATCATATCAACAAGTTTCCCCGGTGTC
GCGCTGATGGACTATAGAAAAAAAGGGGATGAGGAACTAGACCTAGTGGAGGGGGAACAATTAAGGGTGTTTAAA
CGATATAACCACTGGTCATATGTCAGTCATTTTTGCCGAATCAAATCCTCCATATTCATCAAATAAATTATTGCA
GGCTGTGAAAGAGCAGGGCGGTGATAGAGGATGGGTACCGGTACGTAATACCATTGATCCATTTTCAACTTATAT
TCAGTGATGTCTGCAGTCTTGGTTTATCGGCAAAGTCAGCAGCCATCTTGGAAATTCGCCTAACACTCCAGCATC
TGGTACGACGGGACATGCACCATCATCGTCCACTTCCAACTTTGAAGATATGACACAAACCCAAGTATCGCCCAT
GTCTTCTGCTTTTCCACCTGTACAGCCCGCAAAGTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail