Protein ID | Agabi119p4|092880 |
Gene name | |
Location | scaffold_06:1203520..1204148 |
Strand | - |
Gene length (bp) | 628 |
Transcript length (bp) | 399 |
Coding sequence length (bp) | 399 |
Protein length (aa) | 133 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01641 | SelR | SelR domain | 7.3E-52 | 8 | 127 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9C5C8|MSRB2_ARATH | Peptide methionine sulfoxide reductase B2, chloroplastic OS=Arabidopsis thaliana GN=MSRB2 PE=1 SV=1 | 3 | 126 | 4.0E-66 |
sp|Q10L32|MSRB5_ORYSJ | Peptide methionine sulfoxide reductase B5 OS=Oryza sativa subsp. japonica GN=MSRB5 PE=2 SV=1 | 3 | 126 | 2.0E-64 |
sp|Q9M0Z6|MSRB3_ARATH | Peptide methionine sulfoxide reductase B3 OS=Arabidopsis thaliana GN=MSRB3 PE=2 SV=2 | 3 | 126 | 3.0E-63 |
sp|Q6AUK5|MSRB3_ORYSJ | Peptide methionine sulfoxide reductase B3, chloroplastic OS=Oryza sativa subsp. japonica GN=MSRB3 PE=2 SV=1 | 3 | 126 | 7.0E-63 |
sp|Q9ZS91|MSRB5_ARATH | Peptide methionine sulfoxide reductase B5 OS=Arabidopsis thaliana GN=MSRB5 PE=1 SV=1 | 3 | 130 | 3.0E-62 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9C5C8|MSRB2_ARATH | Peptide methionine sulfoxide reductase B2, chloroplastic OS=Arabidopsis thaliana GN=MSRB2 PE=1 SV=1 | 3 | 126 | 4.0E-66 |
sp|Q10L32|MSRB5_ORYSJ | Peptide methionine sulfoxide reductase B5 OS=Oryza sativa subsp. japonica GN=MSRB5 PE=2 SV=1 | 3 | 126 | 2.0E-64 |
sp|Q9M0Z6|MSRB3_ARATH | Peptide methionine sulfoxide reductase B3 OS=Arabidopsis thaliana GN=MSRB3 PE=2 SV=2 | 3 | 126 | 3.0E-63 |
sp|Q6AUK5|MSRB3_ORYSJ | Peptide methionine sulfoxide reductase B3, chloroplastic OS=Oryza sativa subsp. japonica GN=MSRB3 PE=2 SV=1 | 3 | 126 | 7.0E-63 |
sp|Q9ZS91|MSRB5_ARATH | Peptide methionine sulfoxide reductase B5 OS=Arabidopsis thaliana GN=MSRB5 PE=1 SV=1 | 3 | 130 | 3.0E-62 |
sp|O49707|MSRB8_ARATH | Peptide methionine sulfoxide reductase B8 OS=Arabidopsis thaliana GN=MSRB8 PE=2 SV=1 | 3 | 126 | 3.0E-60 |
sp|Q84JT6|MSRB9_ARATH | Peptide methionine sulfoxide reductase B9 OS=Arabidopsis thaliana GN=MSRB9 PE=2 SV=1 | 3 | 132 | 6.0E-60 |
sp|Q8VY86|MSRB7_ARATH | Peptide methionine sulfoxide reductase B7 OS=Arabidopsis thaliana GN=MSRB7 PE=2 SV=1 | 3 | 126 | 1.0E-59 |
sp|Q9M0Z5|MSRB4_ARATH | Peptide methionine sulfoxide reductase B4 OS=Arabidopsis thaliana GN=MSRB4 PE=2 SV=1 | 3 | 130 | 2.0E-57 |
sp|Q8GWF4|MSRB6_ARATH | Peptide methionine sulfoxide reductase B6 OS=Arabidopsis thaliana GN=MSRB6 PE=2 SV=1 | 1 | 126 | 3.0E-57 |
sp|Q9Y7K1|YGL4_SCHPO | Uncharacterized protein C216.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC216.04c PE=3 SV=1 | 4 | 126 | 6.0E-52 |
sp|Q6ADJ8|MSRB_LEIXX | Peptide methionine sulfoxide reductase MsrB OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=msrB PE=3 SV=1 | 4 | 126 | 2.0E-42 |
sp|P25566|MXR2_YEAST | Peptide methionine sulfoxide reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MXR2 PE=1 SV=1 | 5 | 128 | 2.0E-42 |
sp|Q8UGX7|MSRB_AGRFC | Peptide methionine sulfoxide reductase MsrB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=msrB PE=3 SV=1 | 3 | 127 | 8.0E-42 |
sp|Q8PWF5|MSRB_METMA | Peptide methionine sulfoxide reductase MsrB OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=msrB PE=3 SV=1 | 4 | 126 | 6.0E-41 |
sp|Q46EH1|MSRB_METBF | Peptide methionine sulfoxide reductase MsrB OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=msrB PE=3 SV=1 | 4 | 130 | 2.0E-40 |
sp|Q1QXV3|MSRB_CHRSD | Peptide methionine sulfoxide reductase MsrB OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msrB PE=3 SV=1 | 3 | 130 | 2.0E-39 |
sp|C5BR54|MSRB_TERTT | Peptide methionine sulfoxide reductase MsrB OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=msrB PE=3 SV=1 | 2 | 132 | 6.0E-39 |
sp|B1J4W5|MSRB_PSEPW | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas putida (strain W619) GN=msrB PE=3 SV=1 | 3 | 131 | 1.0E-38 |
sp|Q8F7W8|MSRB_LEPIN | Peptide methionine sulfoxide reductase MsrB OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=msrB PE=3 SV=3 | 3 | 128 | 1.0E-38 |
sp|Q72NN2|MSRB_LEPIC | Peptide methionine sulfoxide reductase MsrB OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=msrB PE=3 SV=3 | 3 | 128 | 1.0E-38 |
sp|Q3SJU1|MSRB_THIDA | Peptide methionine sulfoxide reductase MsrB OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msrB PE=3 SV=1 | 4 | 126 | 8.0E-38 |
sp|Q2SJP9|MSRB_HAHCH | Peptide methionine sulfoxide reductase MsrB OS=Hahella chejuensis (strain KCTC 2396) GN=msrB PE=3 SV=1 | 3 | 131 | 1.0E-37 |
sp|A2SGN7|MSRB_METPP | Peptide methionine sulfoxide reductase MsrB OS=Methylibium petroleiphilum (strain PM1) GN=msrB PE=3 SV=1 | 3 | 130 | 9.0E-37 |
sp|O26807|MSRB_METTH | Peptide methionine sulfoxide reductase MsrB OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=msrB PE=1 SV=1 | 5 | 126 | 2.0E-36 |
sp|Q89EM9|MSRB_BRADU | Peptide methionine sulfoxide reductase MsrB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=msrB PE=3 SV=1 | 4 | 127 | 3.0E-36 |
sp|C3K735|MSRB_PSEFS | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas fluorescens (strain SBW25) GN=msrB PE=3 SV=1 | 3 | 126 | 3.0E-36 |
sp|Q1ID16|MSRB_PSEE4 | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas entomophila (strain L48) GN=msrB PE=3 SV=1 | 3 | 126 | 4.0E-36 |
sp|Q8XYL1|MSRB_RALSO | Peptide methionine sulfoxide reductase MsrB OS=Ralstonia solanacearum (strain GMI1000) GN=msrB PE=3 SV=1 | 3 | 126 | 6.0E-36 |
sp|B0VC45|MSRB_ACIBY | Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain AYE) GN=msrB PE=3 SV=1 | 3 | 126 | 9.0E-36 |
sp|A3M4Q3|MSRB_ACIBT | Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=msrB PE=3 SV=2 | 3 | 126 | 9.0E-36 |
sp|B2HYT2|MSRB_ACIBC | Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain ACICU) GN=msrB PE=3 SV=1 | 3 | 126 | 9.0E-36 |
sp|B7I415|MSRB_ACIB5 | Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain AB0057) GN=msrB PE=3 SV=1 | 3 | 126 | 9.0E-36 |
sp|B7H3X2|MSRB_ACIB3 | Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain AB307-0294) GN=msrB PE=3 SV=1 | 3 | 126 | 9.0E-36 |
sp|B0VR86|MSRB_ACIBS | Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain SDF) GN=msrB PE=3 SV=1 | 3 | 126 | 1.0E-35 |
sp|Q88LQ6|MSRB_PSEPK | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas putida (strain KT2440) GN=msrB PE=3 SV=1 | 4 | 126 | 1.0E-35 |
sp|B0KUQ0|MSRB_PSEPG | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas putida (strain GB-1) GN=msrB PE=3 SV=1 | 4 | 126 | 1.0E-35 |
sp|B0BYW4|MSRB_ACAM1 | Peptide methionine sulfoxide reductase MsrB OS=Acaryochloris marina (strain MBIC 11017) GN=msrB PE=3 SV=1 | 3 | 126 | 2.0E-35 |
sp|Q6FAL8|MSRB_ACIAD | Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msrB PE=3 SV=1 | 3 | 126 | 2.0E-35 |
sp|Q48FR2|MSRB_PSE14 | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msrB PE=3 SV=1 | 3 | 126 | 3.0E-35 |
sp|Q3K935|MSRB_PSEPF | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas fluorescens (strain Pf0-1) GN=msrB PE=3 SV=1 | 4 | 126 | 4.0E-35 |
sp|Q4ZQC6|MSRB_PSEU2 | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msrB PE=3 SV=1 | 3 | 126 | 6.0E-35 |
sp|Q47EU6|MSRB_DECAR | Peptide methionine sulfoxide reductase MsrB OS=Dechloromonas aromatica (strain RCB) GN=msrB PE=3 SV=1 | 4 | 128 | 9.0E-35 |
sp|Q4K8U5|MSRB_PSEF5 | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msrB PE=3 SV=1 | 4 | 126 | 2.0E-34 |
sp|A5W756|MSRB_PSEP1 | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=msrB PE=3 SV=1 | 4 | 126 | 2.0E-34 |
sp|A4G5V5|MSRB_HERAR | Peptide methionine sulfoxide reductase MsrB OS=Herminiimonas arsenicoxydans GN=msrB PE=3 SV=1 | 4 | 127 | 2.0E-34 |
sp|Q21LK2|MSRB_SACD2 | Peptide methionine sulfoxide reductase MsrB OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msrB PE=3 SV=1 | 1 | 126 | 2.0E-34 |
sp|Q92RA4|MSRB1_RHIME | Peptide methionine sulfoxide reductase MsrB 1 OS=Rhizobium meliloti (strain 1021) GN=msrB1 PE=3 SV=2 | 4 | 128 | 3.0E-34 |
sp|Q8DJK9|MSRB_THEEB | Peptide methionine sulfoxide reductase MsrB OS=Thermosynechococcus elongatus (strain BP-1) GN=msrB PE=3 SV=1 | 4 | 126 | 8.0E-34 |
sp|A5GQT3|MSRB_SYNR3 | Peptide methionine sulfoxide reductase MsrB OS=Synechococcus sp. (strain RCC307) GN=msrB PE=3 SV=1 | 5 | 128 | 3.0E-33 |
sp|C1DRM1|MSRB_AZOVD | Peptide methionine sulfoxide reductase MsrB OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=msrB PE=3 SV=1 | 3 | 129 | 5.0E-33 |
sp|Q9C8M2|MSRB1_ARATH | Peptide methionine sulfoxide reductase B1, chloroplastic OS=Arabidopsis thaliana GN=MSRB1 PE=1 SV=1 | 5 | 127 | 5.0E-33 |
sp|B4RUW0|MSRB_ALTMD | Peptide methionine sulfoxide reductase MsrB OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=msrB PE=3 SV=1 | 5 | 126 | 6.0E-33 |
sp|Q885Q1|MSRB_PSESM | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msrB PE=3 SV=1 | 3 | 126 | 1.0E-32 |
sp|A1VNB7|MSRB_POLNA | Peptide methionine sulfoxide reductase MsrB OS=Polaromonas naphthalenivorans (strain CJ2) GN=msrB PE=3 SV=1 | 3 | 126 | 1.0E-32 |
sp|C5CNS9|MSRB_VARPS | Peptide methionine sulfoxide reductase MsrB OS=Variovorax paradoxus (strain S110) GN=msrB PE=3 SV=1 | 4 | 126 | 4.0E-32 |
sp|Q87MS5|MSRB_VIBPA | Peptide methionine sulfoxide reductase MsrB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msrB PE=3 SV=1 | 4 | 129 | 5.0E-32 |
sp|Q5R930|MSRB3_PONAB | Methionine-R-sulfoxide reductase B3 OS=Pongo abelii GN=MSRB3 PE=2 SV=2 | 5 | 126 | 5.0E-32 |
sp|Q8IXL7|MSRB3_HUMAN | Methionine-R-sulfoxide reductase B3 OS=Homo sapiens GN=MSRB3 PE=1 SV=2 | 5 | 126 | 1.0E-31 |
sp|Q12AE4|MSRB_POLSJ | Peptide methionine sulfoxide reductase MsrB OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msrB PE=3 SV=1 | 3 | 126 | 1.0E-31 |
sp|B3PK10|MSRB_CELJU | Peptide methionine sulfoxide reductase MsrB OS=Cellvibrio japonicus (strain Ueda107) GN=msrB PE=3 SV=1 | 5 | 127 | 3.0E-31 |
sp|P65449|MSRB_SALTY | Peptide methionine sulfoxide reductase MsrB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msrB PE=3 SV=1 | 2 | 131 | 3.0E-31 |
sp|P65450|MSRB_SALTI | Peptide methionine sulfoxide reductase MsrB OS=Salmonella typhi GN=msrB PE=3 SV=1 | 2 | 131 | 3.0E-31 |
sp|B4TUA8|MSRB_SALSV | Peptide methionine sulfoxide reductase MsrB OS=Salmonella schwarzengrund (strain CVM19633) GN=msrB PE=3 SV=1 | 2 | 131 | 3.0E-31 |
sp|A9N292|MSRB_SALPB | Peptide methionine sulfoxide reductase MsrB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=msrB PE=3 SV=1 | 2 | 131 | 3.0E-31 |
sp|B4T3Y1|MSRB_SALNS | Peptide methionine sulfoxide reductase MsrB OS=Salmonella newport (strain SL254) GN=msrB PE=3 SV=1 | 2 | 131 | 3.0E-31 |
sp|B4TGC8|MSRB_SALHS | Peptide methionine sulfoxide reductase MsrB OS=Salmonella heidelberg (strain SL476) GN=msrB PE=3 SV=1 | 2 | 131 | 3.0E-31 |
sp|B5FJF9|MSRB_SALDC | Peptide methionine sulfoxide reductase MsrB OS=Salmonella dublin (strain CT_02021853) GN=msrB PE=3 SV=1 | 2 | 131 | 3.0E-31 |
sp|Q8BU85|MSRB3_MOUSE | Methionine-R-sulfoxide reductase B3, mitochondrial OS=Mus musculus GN=Msrb3 PE=1 SV=2 | 5 | 126 | 4.0E-31 |
sp|Q3Z2B6|MSRB_SHISS | Peptide methionine sulfoxide reductase MsrB OS=Shigella sonnei (strain Ss046) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|B1LDV3|MSRB_ECOSM | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|B6IBJ9|MSRB_ECOSE | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain SE11) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|B7N5B4|MSRB_ECOLU | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|P0A746|MSRB_ECOLI | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12) GN=msrB PE=1 SV=1 | 2 | 131 | 7.0E-31 |
sp|P0A747|MSRB_ECOL6 | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|Q0TH50|MSRB_ECOL5 | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|B1XGN8|MSRB_ECODH | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12 / DH10B) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|C4ZZD4|MSRB_ECOBW | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|B7NSZ8|MSRB_ECO7I | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|B5YQ71|MSRB_ECO5E | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|P0A748|MSRB_ECO57 | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O157:H7 GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|B7L6Q3|MSRB_ECO55 | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain 55989 / EAEC) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|B7USF8|MSRB_ECO27 | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|A7ZMP8|MSRB_ECO24 | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=msrB PE=3 SV=1 | 2 | 131 | 7.0E-31 |
sp|B7MAY9|MSRB_ECO45 | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=msrB PE=3 SV=1 | 2 | 131 | 8.0E-31 |
sp|B7MVQ9|MSRB_ECO81 | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O81 (strain ED1a) GN=msrB PE=3 SV=1 | 2 | 131 | 9.0E-31 |
sp|Q83L66|MSRB_SHIFL | Peptide methionine sulfoxide reductase MsrB OS=Shigella flexneri GN=msrB PE=3 SV=1 | 2 | 131 | 9.0E-31 |
sp|Q0T4Y5|MSRB_SHIF8 | Peptide methionine sulfoxide reductase MsrB OS=Shigella flexneri serotype 5b (strain 8401) GN=msrB PE=3 SV=1 | 2 | 131 | 9.0E-31 |
sp|Q321R4|MSRB_SHIBS | Peptide methionine sulfoxide reductase MsrB OS=Shigella boydii serotype 4 (strain Sb227) GN=msrB PE=3 SV=1 | 2 | 131 | 9.0E-31 |
sp|B1IPF3|MSRB_ECOLC | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=msrB PE=3 SV=1 | 2 | 131 | 9.0E-31 |
sp|A8A0X0|MSRB_ECOHS | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O9:H4 (strain HS) GN=msrB PE=3 SV=1 | 2 | 131 | 9.0E-31 |
sp|B7M1J2|MSRB_ECO8A | Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O8 (strain IAI1) GN=msrB PE=3 SV=1 | 2 | 131 | 9.0E-31 |
sp|B5F860|MSRB_SALA4 | Peptide methionine sulfoxide reductase MsrB OS=Salmonella agona (strain SL483) GN=msrB PE=3 SV=1 | 2 | 131 | 1.0E-30 |
sp|A9MFH4|MSRB_SALAR | Peptide methionine sulfoxide reductase MsrB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=msrB PE=3 SV=1 | 2 | 131 | 1.0E-30 |
sp|Q2SWN9|MSRB_BURTA | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msrB PE=3 SV=1 | 4 | 127 | 2.0E-30 |
sp|B5XS71|MSRB_KLEP3 | Peptide methionine sulfoxide reductase MsrB OS=Klebsiella pneumoniae (strain 342) GN=msrB PE=3 SV=1 | 2 | 132 | 2.0E-30 |
sp|Q39FG2|MSRB_BURL3 | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msrB PE=3 SV=1 | 4 | 127 | 2.0E-30 |
sp|A6T7R0|MSRB_KLEP7 | Peptide methionine sulfoxide reductase MsrB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=msrB PE=3 SV=1 | 2 | 132 | 2.0E-30 |
sp|A4XVB1|MSRB_PSEMY | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas mendocina (strain ymp) GN=msrB PE=3 SV=1 | 3 | 126 | 2.0E-30 |
sp|Q0BEH0|MSRB_BURCM | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=msrB PE=3 SV=1 | 3 | 127 | 2.0E-30 |
sp|Q63V23|MSRB_BURPS | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia pseudomallei (strain K96243) GN=msrB PE=3 SV=1 | 4 | 127 | 2.0E-30 |
sp|A1V4U8|MSRB_BURMS | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia mallei (strain SAVP1) GN=msrB PE=3 SV=1 | 4 | 127 | 2.0E-30 |
sp|Q62JM6|MSRB_BURMA | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia mallei (strain ATCC 23344) GN=msrB PE=3 SV=1 | 4 | 127 | 2.0E-30 |
sp|A2SBI6|MSRB_BURM9 | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia mallei (strain NCTC 10229) GN=msrB PE=3 SV=1 | 4 | 127 | 2.0E-30 |
sp|Q32GC7|MSRB_SHIDS | Peptide methionine sulfoxide reductase MsrB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msrB PE=3 SV=1 | 2 | 131 | 3.0E-30 |
sp|Q0A706|MSRB_ALKEH | Peptide methionine sulfoxide reductase MsrB OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msrB PE=3 SV=1 | 3 | 126 | 3.0E-30 |
sp|Q8INK9|MSRB_DROME | Methionine-R-sulfoxide reductase B1 OS=Drosophila melanogaster GN=SelR PE=1 SV=3 | 1 | 126 | 4.0E-30 |
sp|A9AJS6|MSRB_BURM1 | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=msrB PE=3 SV=1 | 4 | 127 | 4.0E-30 |
sp|A4JEZ1|MSRB_BURVG | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=msrB PE=3 SV=1 | 3 | 127 | 4.0E-30 |
sp|A0K833|MSRB_BURCH | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia cenocepacia (strain HI2424) GN=msrB PE=3 SV=1 | 3 | 127 | 6.0E-30 |
sp|Q1BH71|MSRB_BURCA | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia cenocepacia (strain AU 1054) GN=msrB PE=3 SV=1 | 3 | 127 | 6.0E-30 |
sp|Q3JRF0|MSRB_BURP1 | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia pseudomallei (strain 1710b) GN=msrB PE=1 SV=1 | 4 | 127 | 6.0E-30 |
sp|B4EBK9|MSRB_BURCJ | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=msrB PE=3 SV=1 | 3 | 127 | 6.0E-30 |
sp|B1JTT6|MSRB_BURCC | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia cenocepacia (strain MC0-3) GN=msrB PE=3 SV=1 | 3 | 127 | 6.0E-30 |
sp|B1YRN6|MSRB_BURA4 | Peptide methionine sulfoxide reductase MsrB OS=Burkholderia ambifaria (strain MC40-6) GN=msrB PE=3 SV=1 | 3 | 127 | 6.0E-30 |
sp|P34436|YL56_CAEEL | Uncharacterized protein F44E2.6 OS=Caenorhabditis elegans GN=F44E2.6 PE=3 SV=1 | 6 | 128 | 2.0E-29 |
sp|Q0DC89|MSRB1_ORYSJ | Peptide methionine sulfoxide reductase B1, chloroplastic OS=Oryza sativa subsp. japonica GN=MSRB1 PE=2 SV=2 | 5 | 130 | 2.0E-29 |
sp|Q8D849|MSRB_VIBVU | Peptide methionine sulfoxide reductase MsrB OS=Vibrio vulnificus (strain CMCP6) GN=msrB PE=3 SV=2 | 4 | 128 | 2.0E-29 |
sp|Q7MMC4|MSRB_VIBVY | Peptide methionine sulfoxide reductase MsrB OS=Vibrio vulnificus (strain YJ016) GN=msrB PE=3 SV=1 | 4 | 128 | 3.0E-29 |
sp|B7LQ21|MSRB_ESCF3 | Peptide methionine sulfoxide reductase MsrB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=msrB PE=3 SV=1 | 2 | 130 | 3.0E-29 |
sp|Q9CMB1|MSRB_PASMU | Peptide methionine sulfoxide reductase MsrB OS=Pasteurella multocida (strain Pm70) GN=msrB PE=3 SV=1 | 10 | 130 | 4.0E-29 |
sp|A6V3R3|MSRB_PSEA7 | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain PA7) GN=msrB PE=3 SV=1 | 3 | 126 | 5.0E-29 |
sp|Q88W33|MSRB_LACPL | Peptide methionine sulfoxide reductase MsrB OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=msrB PE=3 SV=1 | 3 | 126 | 1.0E-28 |
sp|Q78J03|MSRB2_MOUSE | Methionine-R-sulfoxide reductase B2, mitochondrial OS=Mus musculus GN=Msrb2 PE=1 SV=1 | 5 | 130 | 1.0E-28 |
sp|Q9I016|MSRB_PSEAE | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msrB PE=3 SV=1 | 3 | 126 | 2.0E-28 |
sp|Q02NZ0|MSRB_PSEAB | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=msrB PE=3 SV=1 | 3 | 126 | 2.0E-28 |
sp|B7UUZ9|MSRB_PSEA8 | Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain LESB58) GN=msrB PE=3 SV=1 | 3 | 126 | 2.0E-28 |
sp|Q4FZX5|MSRB2_RAT | Methionine-R-sulfoxide reductase B2, mitochondrial OS=Rattus norvegicus GN=Msrb2 PE=2 SV=1 | 5 | 130 | 4.0E-28 |
sp|Q9Y3D2|MSRB2_HUMAN | Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens GN=MSRB2 PE=1 SV=2 | 5 | 130 | 3.0E-27 |
sp|B2VJ36|MSRB_ERWT9 | Peptide methionine sulfoxide reductase MsrB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=msrB PE=3 SV=1 | 13 | 131 | 6.0E-27 |
sp|B1JLG2|MSRB_YERPY | Peptide methionine sulfoxide reductase MsrB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=msrB PE=3 SV=1 | 13 | 132 | 7.0E-27 |
sp|Q66AP6|MSRB_YERPS | Peptide methionine sulfoxide reductase MsrB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msrB PE=3 SV=1 | 13 | 132 | 7.0E-27 |
sp|A4TJB4|MSRB_YERPP | Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis (strain Pestoides F) GN=msrB PE=3 SV=1 | 13 | 132 | 7.0E-27 |
sp|Q1CJ76|MSRB_YERPN | Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msrB PE=3 SV=1 | 13 | 132 | 7.0E-27 |
sp|A9R9C4|MSRB_YERPG | Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=msrB PE=3 SV=1 | 13 | 132 | 7.0E-27 |
sp|Q8ZEK7|MSRB_YERPE | Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis GN=msrB PE=3 SV=1 | 13 | 132 | 7.0E-27 |
sp|B2K3R4|MSRB_YERPB | Peptide methionine sulfoxide reductase MsrB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=msrB PE=3 SV=1 | 13 | 132 | 7.0E-27 |
sp|Q1C7U0|MSRB_YERPA | Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msrB PE=3 SV=1 | 13 | 132 | 7.0E-27 |
sp|A7FI81|MSRB_YERP3 | Peptide methionine sulfoxide reductase MsrB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=msrB PE=3 SV=1 | 13 | 132 | 7.0E-27 |
sp|Q6NW52|MSRB2_DANRE | Methionine-R-sulfoxide reductase B2, mitochondrial OS=Danio rerio GN=msrb2 PE=2 SV=1 | 7 | 126 | 9.0E-27 |
sp|A8GFD8|MSRB_SERP5 | Peptide methionine sulfoxide reductase MsrB OS=Serratia proteamaculans (strain 568) GN=msrB PE=3 SV=1 | 13 | 131 | 2.0E-26 |
sp|A1JQG8|MSRB_YERE8 | Peptide methionine sulfoxide reductase MsrB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=msrB PE=3 SV=1 | 13 | 132 | 3.0E-26 |
sp|C3LNU9|MSRB_VIBCM | Peptide methionine sulfoxide reductase MsrB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=msrB PE=3 SV=1 | 3 | 128 | 3.0E-26 |
sp|Q9KQK0|MSRB_VIBCH | Peptide methionine sulfoxide reductase MsrB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msrB PE=3 SV=1 | 3 | 128 | 3.0E-26 |
sp|A5F6R2|MSRB_VIBC3 | Peptide methionine sulfoxide reductase MsrB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=msrB PE=3 SV=1 | 3 | 128 | 3.0E-26 |
sp|Q93KF3|MSRAB_CAMFE | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Campylobacter fetus GN=msrAB PE=3 SV=1 | 5 | 126 | 5.0E-26 |
sp|Q1WVT3|MSRB_LACS1 | Peptide methionine sulfoxide reductase MsrB OS=Lactobacillus salivarius (strain UCC118) GN=msrB PE=3 SV=1 | 4 | 126 | 6.0E-26 |
sp|B8GMG5|MSRB_THISH | Peptide methionine sulfoxide reductase MsrB OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=msrB PE=3 SV=1 | 5 | 126 | 6.0E-26 |
sp|Q92Y46|MSRB2_RHIME | Peptide methionine sulfoxide reductase MsrB 2 OS=Rhizobium meliloti (strain 1021) GN=msrB2 PE=3 SV=1 | 1 | 126 | 8.0E-26 |
sp|Q7N400|MSRB_PHOLL | Peptide methionine sulfoxide reductase MsrB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msrB PE=3 SV=1 | 1 | 132 | 2.0E-25 |
sp|Q9PF29|MSRB_XYLFA | Peptide methionine sulfoxide reductase MsrB OS=Xylella fastidiosa (strain 9a5c) GN=msrB PE=3 SV=1 | 11 | 126 | 5.0E-25 |
sp|C0M8H8|MSRB_STRE4 | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus equi subsp. equi (strain 4047) GN=msrB PE=3 SV=1 | 4 | 126 | 1.0E-24 |
sp|Q99ZV6|MSRB_STRP1 | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M1 GN=msrB PE=3 SV=1 | 18 | 126 | 2.0E-24 |
sp|P0DC43|MSRB_STRPQ | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=msrB PE=3 SV=1 | 18 | 126 | 2.0E-24 |
sp|P0DC42|MSRB_STRP3 | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=msrB PE=3 SV=1 | 18 | 126 | 2.0E-24 |
sp|Q8P172|MSRB_STRP8 | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=msrB PE=3 SV=1 | 18 | 126 | 2.0E-24 |
sp|P65448|MSRB_BRUSU | Peptide methionine sulfoxide reductase MsrB OS=Brucella suis biovar 1 (strain 1330) GN=msrB PE=3 SV=1 | 1 | 126 | 3.0E-24 |
sp|P65447|MSRB_BRUME | Peptide methionine sulfoxide reductase MsrB OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=msrB PE=3 SV=1 | 1 | 126 | 3.0E-24 |
sp|C0MDV8|MSRB_STRS7 | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=msrB PE=3 SV=1 | 4 | 126 | 4.0E-24 |
sp|Q87AJ9|MSRB_XYLFT | Peptide methionine sulfoxide reductase MsrB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msrB PE=3 SV=1 | 11 | 126 | 4.0E-24 |
sp|B2I8Y4|MSRB_XYLF2 | Peptide methionine sulfoxide reductase MsrB OS=Xylella fastidiosa (strain M23) GN=msrB PE=3 SV=1 | 11 | 126 | 4.0E-24 |
sp|Q9RUK6|MSRB_DEIRA | Peptide methionine sulfoxide reductase MsrB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=msrB PE=3 SV=1 | 1 | 126 | 5.0E-24 |
sp|Q5XCD0|MSRB_STRP6 | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=msrB PE=3 SV=1 | 18 | 126 | 7.0E-24 |
sp|C6DGV8|MSRB_PECCP | Peptide methionine sulfoxide reductase MsrB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=msrB PE=3 SV=1 | 13 | 126 | 9.0E-24 |
sp|Q6D4P7|MSRB_PECAS | Peptide methionine sulfoxide reductase MsrB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msrB PE=3 SV=1 | 13 | 126 | 2.0E-23 |
sp|E6ESW1|MSRB_ENTFT | Peptide methionine sulfoxide reductase MsrB OS=Enterococcus faecalis (strain TX4000 / JH2-2) GN=msrB PE=1 SV=2 | 1 | 126 | 5.0E-23 |
sp|P0DM32|MSRB_ENTFA | Peptide methionine sulfoxide reductase MsrB OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=msrB PE=3 SV=1 | 1 | 126 | 5.0E-23 |
sp|P47686|MSRB_MYCGE | Peptide methionine sulfoxide reductase MsrB OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=msrB PE=3 SV=1 | 4 | 126 | 1.0E-22 |
sp|Q9KCX2|MSRB_BACHD | Peptide methionine sulfoxide reductase MsrB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=msrB PE=3 SV=1 | 8 | 126 | 3.0E-22 |
sp|P14930|MSRAB_NEIGO | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria gonorrhoeae GN=msrAB PE=1 SV=2 | 5 | 126 | 3.0E-22 |
sp|Q9LAM9|MSRAB_STRGC | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=msrAB PE=3 SV=1 | 5 | 126 | 4.0E-22 |
sp|P75129|MSRB_MYCPN | Peptide methionine sulfoxide reductase MsrB OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=msrB PE=3 SV=1 | 4 | 126 | 4.0E-22 |
sp|P45213|MSRAB_HAEIN | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msrAB PE=1 SV=1 | 5 | 126 | 5.0E-22 |
sp|Q9K1N8|MSRAB_NEIMB | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria meningitidis serogroup B (strain MC58) GN=msrAB PE=3 SV=1 | 5 | 126 | 5.0E-22 |
sp|Q9JWM8|MSRAB_NEIMA | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msrAB PE=1 SV=1 | 5 | 126 | 5.0E-22 |
sp|Q97IU0|MSRB_CLOAB | Peptide methionine sulfoxide reductase MsrB OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=msrB PE=3 SV=1 | 13 | 126 | 6.0E-22 |
sp|Q9ZNJ9|MSRB_CLOHI | Peptide methionine sulfoxide reductase MsrB OS=Clostridium histolyticum GN=msrB PE=3 SV=1 | 1 | 126 | 6.0E-22 |
sp|Q5WH73|MSRB_BACSK | Peptide methionine sulfoxide reductase MsrB OS=Bacillus clausii (strain KSM-K16) GN=msrB PE=3 SV=1 | 1 | 126 | 7.0E-22 |
sp|Q8E026|MSRB_STRA5 | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=msrB PE=3 SV=1 | 4 | 126 | 7.0E-22 |
sp|Q8E5Q9|MSRB_STRA3 | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus agalactiae serotype III (strain NEM316) GN=msrB PE=3 SV=1 | 4 | 126 | 7.0E-22 |
sp|Q3K1F5|MSRB_STRA1 | Peptide methionine sulfoxide reductase MsrB OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=msrB PE=3 SV=1 | 4 | 126 | 7.0E-22 |
sp|P65444|MSAB2_STRR6 | Peptide methionine sulfoxide reductase MsrA/MsrB 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=msrAB2 PE=3 SV=1 | 5 | 126 | 7.0E-22 |
sp|P65443|MSAB2_STRPN | Peptide methionine sulfoxide reductase MsrA/MsrB 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=msrAB2 PE=3 SV=1 | 5 | 126 | 7.0E-22 |
sp|A0AJW4|MSRB_LISW6 | Peptide methionine sulfoxide reductase MsrB OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=msrB PE=3 SV=1 | 1 | 126 | 8.0E-22 |
sp|B1HZH4|MSRB_LYSSC | Peptide methionine sulfoxide reductase MsrB OS=Lysinibacillus sphaericus (strain C3-41) GN=msrB PE=3 SV=1 | 13 | 126 | 9.0E-22 |
sp|Q0SSL4|MSRB_CLOPS | Peptide methionine sulfoxide reductase MsrB OS=Clostridium perfringens (strain SM101 / Type A) GN=msrB PE=3 SV=1 | 12 | 126 | 9.0E-22 |
sp|P54155|MSRB_BACSU | Peptide methionine sulfoxide reductase MsrB OS=Bacillus subtilis (strain 168) GN=msrB PE=1 SV=1 | 13 | 126 | 1.0E-21 |
sp|Q9A6B1|MSRB_CAUCR | Peptide methionine sulfoxide reductase MsrB OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=msrB PE=3 SV=1 | 11 | 126 | 2.0E-21 |
sp|B8GY23|MSRB_CAUCN | Peptide methionine sulfoxide reductase MsrB OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=msrB PE=3 SV=1 | 11 | 126 | 2.0E-21 |
sp|Q032Q9|MSRB_LACLS | Peptide methionine sulfoxide reductase MsrB OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=msrB PE=3 SV=1 | 14 | 126 | 2.0E-21 |
sp|Q8XJZ6|MSRB_CLOPE | Peptide methionine sulfoxide reductase MsrB OS=Clostridium perfringens (strain 13 / Type A) GN=msrB PE=3 SV=1 | 12 | 126 | 2.0E-21 |
sp|Q0TPZ6|MSRB_CLOP1 | Peptide methionine sulfoxide reductase MsrB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=msrB PE=3 SV=1 | 12 | 126 | 2.0E-21 |
sp|Q71YF7|MSRB_LISMF | Peptide methionine sulfoxide reductase MsrB OS=Listeria monocytogenes serotype 4b (strain F2365) GN=msrB PE=3 SV=1 | 1 | 126 | 3.0E-21 |
sp|C1KWF8|MSRB_LISMC | Peptide methionine sulfoxide reductase MsrB OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=msrB PE=3 SV=1 | 1 | 126 | 3.0E-21 |
sp|B8DDP3|MSRB_LISMH | Peptide methionine sulfoxide reductase MsrB OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=msrB PE=3 SV=1 | 1 | 126 | 4.0E-21 |
sp|Q8Y641|MSRB_LISMO | Peptide methionine sulfoxide reductase MsrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=msrB PE=3 SV=1 | 1 | 126 | 4.0E-21 |
sp|Q9AL99|MSRAB_AGGAC | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Aggregatibacter actinomycetemcomitans GN=msrAB PE=3 SV=1 | 5 | 126 | 4.0E-21 |
sp|A2RHS0|MSRB_LACLM | Peptide methionine sulfoxide reductase MsrB OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=msrB PE=3 SV=1 | 14 | 126 | 2.0E-20 |
sp|Q9CJ17|MSRB_LACLA | Peptide methionine sulfoxide reductase MsrB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=msrB PE=3 SV=1 | 18 | 126 | 2.0E-20 |
sp|Q92AE9|MSRB_LISIN | Peptide methionine sulfoxide reductase MsrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=msrB PE=3 SV=1 | 1 | 126 | 3.0E-20 |
sp|P0A3R0|MSAB1_STRR6 | Peptide methionine sulfoxide reductase MsrA/MsrB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=msrAB1 PE=1 SV=1 | 5 | 126 | 3.0E-19 |
sp|P0A3Q9|MSAB1_STRPN | Peptide methionine sulfoxide reductase MsrA/MsrB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=msrAB1 PE=1 SV=1 | 5 | 126 | 3.0E-19 |
sp|Q65ID2|MSRB_BACLD | Peptide methionine sulfoxide reductase MsrB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=msrB PE=3 SV=1 | 1 | 126 | 3.0E-19 |
sp|P86890|MSRAB_ENTFL | Peptide methionine sulfoxide reductase msrA/msrB OS=Enterococcus faecalis GN=msrAB PE=1 SV=1 | 5 | 126 | 6.0E-19 |
sp|A7Z5S1|MSRB_BACMF | Peptide methionine sulfoxide reductase MsrB OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=msrB PE=3 SV=1 | 13 | 126 | 6.0E-19 |
sp|P0DC41|MSRAB_STRPQ | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=msrAB PE=3 SV=1 | 5 | 126 | 8.0E-19 |
sp|P0DC40|MSRAB_STRP3 | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=msrAB PE=3 SV=1 | 5 | 126 | 8.0E-19 |
sp|Q72EK2|MSRB_DESVH | Peptide methionine sulfoxide reductase MsrB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=msrB PE=3 SV=1 | 5 | 126 | 9.0E-19 |
sp|Q9KLX6|MSRAB_VIBCH | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msrAB PE=3 SV=2 | 5 | 126 | 1.0E-18 |
sp|O25011|MSRAB_HELPY | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=msrAB PE=3 SV=1 | 5 | 126 | 2.0E-18 |
sp|A8FEA3|MSRB_BACP2 | Peptide methionine sulfoxide reductase MsrB OS=Bacillus pumilus (strain SAFR-032) GN=msrB PE=3 SV=1 | 1 | 126 | 2.0E-18 |
sp|Q9ZMK8|MSRAB_HELPJ | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=msrAB PE=3 SV=1 | 5 | 126 | 2.0E-18 |
sp|Q8P046|MSRAB_STRP8 | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=msrAB PE=3 SV=2 | 5 | 126 | 4.0E-18 |
sp|Q5XAX5|MSRAB_STRP6 | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=msrAB PE=3 SV=2 | 5 | 126 | 4.0E-18 |
sp|Q99YT1|MSRAB_STRP1 | Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M1 GN=msrAB PE=3 SV=2 | 5 | 126 | 4.0E-18 |
sp|Q8CSK6|MSRB_STAES | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=msrB PE=3 SV=1 | 13 | 126 | 4.0E-17 |
sp|Q5HPB4|MSRB_STAEQ | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=msrB PE=3 SV=1 | 13 | 126 | 4.0E-17 |
sp|Q49XN4|MSRB_STAS1 | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=msrB PE=3 SV=1 | 13 | 126 | 4.0E-17 |
sp|Q4L6D3|MSRB_STAHJ | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus haemolyticus (strain JCSC1435) GN=msrB PE=3 SV=1 | 13 | 126 | 5.0E-17 |
sp|O83641|MSRAB_TREPA | Peptide methionine sulfoxide reductase MsrB/MsrA OS=Treponema pallidum (strain Nichols) GN=msrAB PE=3 SV=1 | 13 | 126 | 9.0E-17 |
sp|B9DNY9|MSRB_STACT | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus carnosus (strain TM300) GN=msrB PE=3 SV=1 | 13 | 126 | 1.0E-16 |
sp|Q2YY44|MSRB_STAAB | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=msrB PE=3 SV=1 | 1 | 126 | 4.0E-16 |
sp|P0A087|MSRB_STAAW | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain MW2) GN=msrB PE=3 SV=1 | 1 | 126 | 4.0E-16 |
sp|A8Z402|MSRB_STAAT | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=msrB PE=3 SV=1 | 1 | 126 | 4.0E-16 |
sp|Q6G9D8|MSRB_STAAS | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain MSSA476) GN=msrB PE=3 SV=1 | 1 | 126 | 4.0E-16 |
sp|A6QGX4|MSRB_STAAE | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain Newman) GN=msrB PE=3 SV=1 | 1 | 126 | 4.0E-16 |
sp|P0A088|MSRB_STAA8 | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain NCTC 8325) GN=msrB PE=1 SV=1 | 1 | 126 | 4.0E-16 |
sp|Q2FH15|MSRB_STAA3 | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain USA300) GN=msrB PE=3 SV=1 | 1 | 126 | 4.0E-16 |
sp|Q6GGY4|MSRB_STAAR | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain MRSA252) GN=msrB PE=3 SV=1 | 1 | 126 | 5.0E-16 |
sp|P99065|MSRB_STAAN | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain N315) GN=msrB PE=1 SV=1 | 1 | 126 | 5.0E-16 |
sp|P65451|MSRB_STAAM | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=msrB PE=3 SV=1 | 1 | 126 | 5.0E-16 |
sp|A5ISV4|MSRB_STAA9 | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain JH9) GN=msrB PE=3 SV=1 | 1 | 126 | 5.0E-16 |
sp|A6U1P3|MSRB_STAA2 | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain JH1) GN=msrB PE=3 SV=1 | 1 | 126 | 5.0E-16 |
sp|A7X2A9|MSRB_STAA1 | Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=msrB PE=3 SV=1 | 1 | 126 | 5.0E-16 |
sp|Q5R869|MSRB1_PONAB | Methionine-R-sulfoxide reductase B1 OS=Pongo abelii GN=MSRB1 PE=3 SV=2 | 41 | 126 | 5.0E-08 |
sp|Q9NZV6|MSRB1_HUMAN | Methionine-R-sulfoxide reductase B1 OS=Homo sapiens GN=MSRB1 PE=1 SV=3 | 41 | 126 | 7.0E-08 |
sp|Q802G6|MSB1A_DANRE | Methionine-R-sulfoxide reductase B1-A OS=Danio rerio GN=msrb1 PE=2 SV=3 | 34 | 126 | 5.0E-07 |
sp|Q52KJ8|MSRB1_RAT | Methionine-R-sulfoxide reductase B1 OS=Rattus norvegicus GN=Msrb1 PE=3 SV=2 | 41 | 126 | 8.0E-07 |
sp|Q3MHL9|MSRB1_BOVIN | Methionine-R-sulfoxide reductase B1 OS=Bos taurus GN=MSRB1 PE=3 SV=2 | 41 | 126 | 1.0E-06 |
sp|Q9JLC3|MSRB1_MOUSE | Methionine-R-sulfoxide reductase B1 OS=Mus musculus GN=Msrb1 PE=1 SV=3 | 41 | 126 | 2.0E-06 |
sp|A1E952|MSRB1_PIG | Methionine-R-sulfoxide reductase B1 OS=Sus scrofa GN=MSRB1 PE=3 SV=2 | 41 | 126 | 2.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0033743 | peptide-methionine (R)-S-oxide reductase activity | Yes |
GO:0016491 | oxidoreductase activity | No |
GO:0003824 | catalytic activity | No |
GO:0016667 | oxidoreductase activity, acting on a sulfur group of donors | No |
GO:0016671 | oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor | No |
GO:0003674 | molecular_function | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 11 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Agabi119p4|092880 MNNKSESEWRAILSPEQFRVLRGKGTERPGTGEYNKFSKEGTYGCAGCGTPLYTSSTKFDSGCGWPAFFDAIPGA VTRHEDSTLGMRRIEITCTACGGHLGHVFKGEGFGTPTDERHCVNSVSLKFDEGKGQ* |
Coding | >Agabi119p4|092880 ATGAATAATAAATCAGAGTCCGAGTGGAGGGCTATTCTCTCCCCCGAGCAGTTCAGGGTCTTGAGAGGAAAGGGA ACTGAACGTCCTGGGACCGGCGAATATAACAAATTCAGTAAAGAAGGAACGTATGGTTGTGCAGGATGTGGAACG CCATTGTATACCAGTTCGACGAAATTTGATAGTGGTTGTGGATGGCCAGCTTTCTTTGACGCTATCCCTGGTGCT GTGACTCGTCATGAAGACAGTACGCTTGGAATGCGTAGGATTGAGATTACTTGTACTGCTTGTGGTGGTCATTTA GGACATGTGTTCAAAGGCGAAGGATTCGGTACCCCGACGGATGAAAGACATTGTGTCAATTCCGTTTCGTTGAAG TTTGATGAGGGGAAGGGTCAATAG |
Transcript | >Agabi119p4|092880 ATGAATAATAAATCAGAGTCCGAGTGGAGGGCTATTCTCTCCCCCGAGCAGTTCAGGGTCTTGAGAGGAAAGGGA ACTGAACGTCCTGGGACCGGCGAATATAACAAATTCAGTAAAGAAGGAACGTATGGTTGTGCAGGATGTGGAACG CCATTGTATACCAGTTCGACGAAATTTGATAGTGGTTGTGGATGGCCAGCTTTCTTTGACGCTATCCCTGGTGCT GTGACTCGTCATGAAGACAGTACGCTTGGAATGCGTAGGATTGAGATTACTTGTACTGCTTGTGGTGGTCATTTA GGACATGTGTTCAAAGGCGAAGGATTCGGTACCCCGACGGATGAAAGACATTGTGTCAATTCCGTTTCGTTGAAG TTTGATGAGGGGAAGGGTCAATAG |
Gene | >Agabi119p4|092880 ATGAATAATAAATCAGAGTCCGAGTGGAGGGCTATTCTCTCCCCCGAGCAGGTAACTTCTTTTTCATCAGAATTC CTCCAGATCCTTTGAAGTAATCCTTGGCATTTCTTAGTTCAGGGTCTTGAGAGGAAAGGGAACTGAACGTCCTGG GACCGGCGAATATAACAAATTCAGTAAAGAAGGAACGTATGGTTGTGCAGGATGTGGAACGCCATTGTATACCAG TTCGACGAAATTTGATGTAAGGATTATATCTCCCATTGATATGTTTTCGTTCTGAATGCTTTTTAGAGTGGTTGT GGATGGCCAGCTTTCTTTGACGGTGAATACTCTTTCCACTCCGCTTGAGTGTTCTCTCTTACTAATCACTGAAAT TGAAAGCTATCCCTGGTGCTGTGACTCGTCATGAAGACAGTACGCTTGGAATGCGTAGGATTGAGATTACTTGTA CTGCTTGTGGTGGTCATTTAGGACATGTGTTCAAAGGCGAAGGATTCGGTACCCCGAGTAGGTTTGATAATCTTT GCTCTCTCATTGGATTCTAATTTGTTTCTCGACTTTTGTAGCGGATGAAAGACATTGTGTCAATTCCGTTTCGTT GAAGTTTGATGAGGGGAAGGGTCAATAG |