Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|092590
Gene name
Locationscaffold_06:1124616..1127537
Strand+
Gene length (bp)2921
Transcript length (bp)2343
Coding sequence length (bp)2343
Protein length (aa) 781

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02366 PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 3.8E-85 69 314
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 2.0E-61 553 768
PF02815 MIR MIR domain 1.3E-18 355 523
PF13231 PMT_2 Dolichyl-phosphate-mannose-protein mannosyltransferase 3.7E-06 150 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46971|PMT4_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT4 PE=1 SV=1 67 763 0.0E+00
sp|O42933|PMT4_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm4 PE=3 SV=1 7 775 0.0E+00
sp|Q59X23|PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT4 PE=2 SV=1 78 773 0.0E+00
sp|Q9Y6A1|POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens GN=POMT1 PE=1 SV=3 70 770 6.0E-114
sp|Q99PR0|POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus GN=Pomt1 PE=2 SV=1 70 770 1.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46971|PMT4_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT4 PE=1 SV=1 67 763 0.0E+00
sp|O42933|PMT4_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm4 PE=3 SV=1 7 775 0.0E+00
sp|Q59X23|PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT4 PE=2 SV=1 78 773 0.0E+00
sp|Q9Y6A1|POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens GN=POMT1 PE=1 SV=3 70 770 6.0E-114
sp|Q99PR0|POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus GN=Pomt1 PE=2 SV=1 70 770 1.0E-111
sp|Q8R2R1|POMT1_MOUSE Protein O-mannosyl-transferase 1 OS=Mus musculus GN=Pomt1 PE=1 SV=1 80 770 5.0E-110
sp|Q2LZ62|POMT1_DROPS Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura GN=rt PE=3 SV=2 70 778 7.0E-107
sp|Q9VTK2|POMT1_DROME Protein O-mannosyltransferase 1 OS=Drosophila melanogaster GN=rt PE=2 SV=2 70 768 1.0E-106
sp|O74189|PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT1 PE=2 SV=1 37 752 6.0E-105
sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura GN=tw PE=3 SV=1 40 768 1.0E-102
sp|P33775|PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT1 PE=1 SV=1 65 768 4.0E-102
sp|Q9W5D4|POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster GN=tw PE=2 SV=1 65 768 1.0E-99
sp|Q9UKY4|POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens GN=POMT2 PE=1 SV=2 8 768 1.0E-98
sp|Q8BGQ4|POMT2_MOUSE Protein O-mannosyl-transferase 2 OS=Mus musculus GN=Pomt2 PE=1 SV=1 4 768 2.0E-97
sp|Q5ADM9|PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT2 PE=1 SV=1 9 704 2.0E-96
sp|P31382|PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT2 PE=1 SV=2 37 681 2.0E-95
sp|Q9C100|PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm2 PE=3 SV=1 11 771 1.0E-89
sp|P47190|PMT3_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT3 PE=1 SV=2 41 753 1.0E-85
sp|P42934|PMT6_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT6 PE=1 SV=1 14 707 3.0E-79
sp|P52867|PMT5_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT5 PE=1 SV=1 59 771 4.0E-77
sp|Q5ACU3|PMT5_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT5 PE=2 SV=1 44 770 1.0E-73
sp|Q5A688|PMT6_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT6 PE=2 SV=1 69 770 1.0E-71
sp|O13898|PMT1_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm1 PE=1 SV=1 44 771 1.0E-67
sp|Q8NRZ6|PMT_CORGL Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pmt PE=3 SV=1 68 304 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0000030 mannosyltransferase activity Yes
GO:0006493 protein O-linked glycosylation Yes
GO:0016020 membrane Yes
GO:0043413 macromolecule glycosylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006486 protein glycosylation No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0070085 glycosylation No
GO:0016757 glycosyltransferase activity No
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0036211 protein modification process No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 61 80 19
2 107 129 22
3 149 171 22
4 176 195 19
5 200 219 19
6 232 249 17
7 254 273 19
8 293 315 22
9 610 632 22
10 653 675 22
11 685 707 22
12 727 749 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|092590
MGGKGKAPETSARLRKRQDNGTSSYSGSVTSESVQNDEHVAEIFQSPRSRSHVEQMLDTPSASMVVVAILTTIAF
ALRFYKISHPDQVVFDEVHFGKFASYYITRQYYFDVHPPFAKLLFGLAGWFVGFDGEFTFDNIGDNYTLNNVPYI
GMRALPAVLGSLTVPIVYAIMKESGYSTIIAAFSASLILFDNAHITQSRLILLDATLIFFMALTIYAYVRFRKLR
YREFSTEWWVWLVLTGVFMACTWGSKVNGILTVACIGIAVLIDLWDILDHKKGTTMDYFYQHFIARAIGLIVIPF
VVYLTFFYIHFSILVQSGSGDLYMSPAFQETLAGNEMLLNSAEIRYHDIITMKHKDTKVFLHSHAENYPLTYEDG
RISSQGQQVTGYAHDDTNNYWQIIPTKAIPETGPGRVVHNGDVVQLLHVNTQTYLLTHDVASSLMPTNQEFTTWP
KDDYKRYNDTLFSVNLIDSDSASWKTKSGYFRLVHVPTKVSMWTHTTPLPEWAFKQQEINGNKNSVEKTAIWFVN
EIVDTDDPEGLDNRLEERPSKKPKSMNFLRKFAELQLLMLQHNAGLTGSHPYASTPINWPFSLTGISFWTENDSQ
KQIYLVGNLLGWWACVVGLSIYIGILGADLIARRRGLDPIADPVRNRLWNNTGFFMLVWAVHYLPFFLFSRQLFI
HHYLPSHLASAMIAGSVLSFILSDTINFPISLRGPKTRPQTTQYADVGTKGVVTTVIFSLVMFVMFSYMAPLTYG
SPGLTGEEVNSRRLLSTWTLHFAAKKTYDA*
Coding >Agabi119p4|092590
ATGGGAGGCAAAGGAAAGGCCCCCGAAACATCCGCGCGTCTTCGTAAACGTCAAGACAATGGTACCTCTTCGTAT
TCGGGGAGTGTGACTTCTGAAAGCGTACAAAACGATGAACATGTTGCTGAGATTTTTCAGAGTCCACGCTCGAGA
AGTCATGTTGAGCAGATGCTTGATACTCCCAGTGCGAGTATGGTAGTTGTTGCTATTTTGACGACGATTGCGTTT
GCTTTGAGGTTTTACAAAATCAGTCATCCTGATCAAGTTGTTTTCGACGAAGTTCATTTTGGAAAATTCGCATCA
TATTATATCACGCGCCAATATTACTTCGACGTCCATCCTCCTTTTGCGAAACTTCTCTTCGGACTAGCAGGCTGG
TTCGTTGGGTTTGATGGAGAATTCACTTTTGACAATATTGGTGATAACTATACTCTTAACAATGTTCCCTATATT
GGAATGCGTGCTCTTCCTGCTGTATTGGGAAGTCTTACGGTCCCCATCGTCTACGCGATTATGAAGGAGAGTGGC
TATTCTACTATCATCGCCGCGTTTTCTGCCTCTCTTATTCTCTTTGACAATGCTCATATCACTCAATCTCGGTTG
ATATTGCTTGATGCAACGTTGATTTTCTTCATGGCTTTGACGATTTATGCATATGTTCGCTTCCGCAAGCTTCGT
TATCGTGAATTTTCAACGGAGTGGTGGGTATGGTTGGTTCTCACTGGCGTTTTTATGGCTTGTACTTGGGGATCC
AAAGTCAATGGTATCCTTACTGTTGCTTGTATTGGTATCGCTGTCCTTATCGATCTATGGGATATTTTGGACCAC
AAGAAGGGAACTACCATGGACTACTTTTACCAGCACTTTATAGCTCGTGCTATTGGTCTTATCGTTATTCCATTC
GTCGTTTATCTCACTTTCTTCTACATCCATTTTTCCATTCTTGTCCAATCTGGCAGTGGCGATCTTTATATGAGC
CCTGCTTTCCAAGAAACATTGGCTGGAAATGAGATGCTCCTGAACAGCGCTGAAATTCGTTATCATGATATCATT
ACCATGAAGCACAAGGATACCAAAGTCTTTTTGCACTCGCACGCTGAAAACTACCCTTTGACGTACGAGGATGGC
CGTATCAGTAGCCAAGGCCAACAAGTTACCGGATATGCTCATGATGATACCAATAATTATTGGCAGATAATCCCC
ACTAAGGCTATCCCTGAAACTGGACCCGGGCGTGTGGTTCATAATGGCGATGTTGTTCAATTGCTTCACGTCAAC
ACTCAAACTTATCTCCTTACCCATGACGTTGCATCCTCTCTGATGCCAACTAATCAGGAATTCACTACTTGGCCA
AAGGATGACTACAAACGATACAATGATACTCTTTTCAGTGTCAACCTCATCGACTCTGACAGCGCCTCTTGGAAG
ACCAAGTCTGGGTATTTCAGGCTAGTTCACGTGCCCACCAAGGTGTCGATGTGGACACACACGACGCCTCTCCCT
GAATGGGCATTCAAACAGCAAGAAATCAATGGTAACAAGAATTCCGTGGAAAAGACGGCTATCTGGTTTGTGAAT
GAGATTGTTGATACTGATGATCCTGAAGGACTTGACAATCGTTTGGAGGAGAGGCCATCGAAGAAACCCAAGTCG
ATGAACTTTTTGAGGAAGTTTGCTGAATTGCAGCTTTTAATGTTACAACATAATGCTGGGTTGACTGGTTCTCAT
CCTTATGCCAGTACACCCATCAACTGGCCCTTCTCTTTGACTGGTATTAGCTTCTGGACCGAAAATGACTCCCAG
AAACAAATTTATCTTGTTGGAAATTTGCTCGGTTGGTGGGCATGTGTGGTCGGGTTGTCAATCTACATTGGTATT
CTTGGAGCCGACCTTATAGCGAGGCGTCGTGGCTTGGATCCTATCGCTGATCCTGTTCGCAACCGTCTATGGAAC
AACACTGGTTTCTTCATGCTCGTGTGGGCTGTCCACTACCTTCCGTTCTTCTTGTTCAGCCGCCAGCTTTTCATC
CATCACTACCTTCCTTCGCACCTTGCCTCTGCTATGATTGCGGGCTCGGTTTTGAGCTTTATTCTTAGCGATACT
ATTAATTTCCCTATCTCCCTCCGTGGACCGAAGACAAGGCCTCAGACTACTCAATATGCTGACGTTGGAACAAAG
GGTGTTGTTACTACTGTGATCTTCAGTCTTGTGATGTTTGTGATGTTCTCATACATGGCACCTTTGACGTATGGC
TCTCCTGGACTGACGGGCGAAGAAGTCAATAGCAGAAGACTTTTGTCGACCTGGACTCTCCATTTTGCGGCTAAA
AAGACATATGATGCGTAG
Transcript >Agabi119p4|092590
ATGGGAGGCAAAGGAAAGGCCCCCGAAACATCCGCGCGTCTTCGTAAACGTCAAGACAATGGTACCTCTTCGTAT
TCGGGGAGTGTGACTTCTGAAAGCGTACAAAACGATGAACATGTTGCTGAGATTTTTCAGAGTCCACGCTCGAGA
AGTCATGTTGAGCAGATGCTTGATACTCCCAGTGCGAGTATGGTAGTTGTTGCTATTTTGACGACGATTGCGTTT
GCTTTGAGGTTTTACAAAATCAGTCATCCTGATCAAGTTGTTTTCGACGAAGTTCATTTTGGAAAATTCGCATCA
TATTATATCACGCGCCAATATTACTTCGACGTCCATCCTCCTTTTGCGAAACTTCTCTTCGGACTAGCAGGCTGG
TTCGTTGGGTTTGATGGAGAATTCACTTTTGACAATATTGGTGATAACTATACTCTTAACAATGTTCCCTATATT
GGAATGCGTGCTCTTCCTGCTGTATTGGGAAGTCTTACGGTCCCCATCGTCTACGCGATTATGAAGGAGAGTGGC
TATTCTACTATCATCGCCGCGTTTTCTGCCTCTCTTATTCTCTTTGACAATGCTCATATCACTCAATCTCGGTTG
ATATTGCTTGATGCAACGTTGATTTTCTTCATGGCTTTGACGATTTATGCATATGTTCGCTTCCGCAAGCTTCGT
TATCGTGAATTTTCAACGGAGTGGTGGGTATGGTTGGTTCTCACTGGCGTTTTTATGGCTTGTACTTGGGGATCC
AAAGTCAATGGTATCCTTACTGTTGCTTGTATTGGTATCGCTGTCCTTATCGATCTATGGGATATTTTGGACCAC
AAGAAGGGAACTACCATGGACTACTTTTACCAGCACTTTATAGCTCGTGCTATTGGTCTTATCGTTATTCCATTC
GTCGTTTATCTCACTTTCTTCTACATCCATTTTTCCATTCTTGTCCAATCTGGCAGTGGCGATCTTTATATGAGC
CCTGCTTTCCAAGAAACATTGGCTGGAAATGAGATGCTCCTGAACAGCGCTGAAATTCGTTATCATGATATCATT
ACCATGAAGCACAAGGATACCAAAGTCTTTTTGCACTCGCACGCTGAAAACTACCCTTTGACGTACGAGGATGGC
CGTATCAGTAGCCAAGGCCAACAAGTTACCGGATATGCTCATGATGATACCAATAATTATTGGCAGATAATCCCC
ACTAAGGCTATCCCTGAAACTGGACCCGGGCGTGTGGTTCATAATGGCGATGTTGTTCAATTGCTTCACGTCAAC
ACTCAAACTTATCTCCTTACCCATGACGTTGCATCCTCTCTGATGCCAACTAATCAGGAATTCACTACTTGGCCA
AAGGATGACTACAAACGATACAATGATACTCTTTTCAGTGTCAACCTCATCGACTCTGACAGCGCCTCTTGGAAG
ACCAAGTCTGGGTATTTCAGGCTAGTTCACGTGCCCACCAAGGTGTCGATGTGGACACACACGACGCCTCTCCCT
GAATGGGCATTCAAACAGCAAGAAATCAATGGTAACAAGAATTCCGTGGAAAAGACGGCTATCTGGTTTGTGAAT
GAGATTGTTGATACTGATGATCCTGAAGGACTTGACAATCGTTTGGAGGAGAGGCCATCGAAGAAACCCAAGTCG
ATGAACTTTTTGAGGAAGTTTGCTGAATTGCAGCTTTTAATGTTACAACATAATGCTGGGTTGACTGGTTCTCAT
CCTTATGCCAGTACACCCATCAACTGGCCCTTCTCTTTGACTGGTATTAGCTTCTGGACCGAAAATGACTCCCAG
AAACAAATTTATCTTGTTGGAAATTTGCTCGGTTGGTGGGCATGTGTGGTCGGGTTGTCAATCTACATTGGTATT
CTTGGAGCCGACCTTATAGCGAGGCGTCGTGGCTTGGATCCTATCGCTGATCCTGTTCGCAACCGTCTATGGAAC
AACACTGGTTTCTTCATGCTCGTGTGGGCTGTCCACTACCTTCCGTTCTTCTTGTTCAGCCGCCAGCTTTTCATC
CATCACTACCTTCCTTCGCACCTTGCCTCTGCTATGATTGCGGGCTCGGTTTTGAGCTTTATTCTTAGCGATACT
ATTAATTTCCCTATCTCCCTCCGTGGACCGAAGACAAGGCCTCAGACTACTCAATATGCTGACGTTGGAACAAAG
GGTGTTGTTACTACTGTGATCTTCAGTCTTGTGATGTTTGTGATGTTCTCATACATGGCACCTTTGACGTATGGC
TCTCCTGGACTGACGGGCGAAGAAGTCAATAGCAGAAGACTTTTGTCGACCTGGACTCTCCATTTTGCGGCTAAA
AAGACATATGATGCGTAG
Gene >Agabi119p4|092590
ATGGGAGGCAAAGGAAAGGCCCCCGAAACATCCGCGCGTCTTCGTAAACGTCAAGACAATGGTACCTCTTCGTAT
TCGGGGAGTGTGACTTCTGAAAGCGTACAAAACGATGAACATGTTGCTGAGATTTTTCAGAGTCCAGTGAGTGCT
TTTTTTTGCTTTATTGGATTGTGTTTTGTGGGTGGACGTGGCTGAATAATTGGTGGTTCTGTGTAGCGCTCGAGA
AGTCATGTTGAGCAGATGCTTGATACTCCCAGTGCGAGTATGGTAGTTGTTGCTATTTTGACGACGATTGCGTTT
GCTTTGAGGTTTTACAAAATCAGTCATCCTGATCAAGTTGTGTACGTGTCTTCCTCTTCTGAAAACAATAAAATA
AATCTAACACGTCGCATCTCAAACCCAGTTTCGACGAAGTTCATTTTGGAAAATTCGCATCATATTATATCACGC
GCCAATATTACTTCGACGTCCATCCTCCTTTTGCGAAACTTCTCTTCGGACTAGCAGGCTGGTTCGTTGGGTTTG
ATGGAGAATTCACTTTTGACAATATTGGTGATAACTATACTCTTAACAATGTTCCCTATATTGGAATGCGTGCTC
TTCCTGCTGTATTGGGAAGTCTTACGGTCCCCATCGTCTACGCGATTATGAAGGAGAGTGGCTATTCTACTATCA
TCGCCGCGTTTTCTGCCTCTCTTATTCTCTTTGGTGCGTCTTTTTGGTTGGACTTGGGTATTACCTGTACTTACC
TTTGGGGGGGTTTGAATCTGCTAGACAATGCTCATATCACTCAATCTCGGTTGATATTGCTTGATGCAACGTTGA
TTTTCTTCATGGCTTTGACGATTTATGCATATGTTCGCTTCCGCAAGCTTCGTTATCGGTATGTGTATGGTGCAG
GTTATTTGTTCTCAGGTGCTGAAAAACGACCAAAAGTGAATTTTCAACGGAGTGGTGGGTATGGTTGGTTCTCAC
TGGCGTTTTTATGGCTTGTACTTGGGGATCCAAAGTCAATGGTATCCTTACTGTTGCTTGTATTGGTATCGCTGT
CCTTATCGATCTATGGGATATTTTGGACCACAAGAAGGGAACTACCATGGTAAGTGACTGGAATGTGTTCATTGT
TACCAATGTTTTGATGACTTGCCGCAGGACTACTTTTACCAGCACTTTATAGCTCGTGCTATTGGTCTTATCGTT
ATTCCATTCGTCGTTTATCTCACTTTCTTCTACATCCATTTTTCCATTCTTGTCCAATCTGGCAGTGGCGATCTT
TATATGAGCCCTGCTTTCCAAGAAACATTGGCTGGAAATGAGATGCTCCTGAACAGCGCTGGTGAGCTGATTTCT
TCCTACATGTATCTGCTCTTGCTCATTAGGCGCCAGAAATTCGTTATCATGATATCATTACCATGAAGCACAAGG
ATACCAAAGTCTTTTTGCACTCGCACGCTGAAAACTACCCTTTGACGTACGAGGATGGCCGTATCAGTAGCCAAG
GTCTGTCGACTGTGGTTTACCATGAGAATTGAAAAGCTGAAACTTCCCCAGGCCAACAAGTTACCGGATATGCTC
ATGATGATACCAATAATTATTGGCAGATAATCCCCACTAAGGCTATCCCTGAAACTGGACCCGGGCGTGTGGTTC
ATAATGGCGATGTTGTTCAATTGCTTCACGTCAACACTCAAACTTATCTCCTTACCCATGACGTTGCATCCTCTC
TGATGCCAACTAATCAGGAATTCACTACTTGGCCAAAGGATGACTACAAACGATACAATGATACTCTTTTCAGTG
TCAACCTCATCGACTCTGACAGCGCCTCTTGGAAGACCAAGTCTGGGTATTTCAGGCTAGTTCACGTGCCCACCA
AGGTGTCGATGTGGACACACACGACGCCTCTCCCTGAATGGGCATTCAAACAGCAAGAAATCAATGGTAACAAGA
ATTCCGTGGAAAAGACGGCTATCTGGTTTGTGAATGAGATTGTTGATACTGATGGTGAGCAAAGCTTCTTAAAAG
CCTTCTTATCTCGCCCCATTAATGTCAATCCAACTTTTAGATCCTGAAGGACTTGACAATCGTTTGGAGGAGAGG
CCATCGAAGAAACCCAAGTCGATGAACTTTTTGAGGAAGTTTGCTGAATTGCAGCTTTTAATGTTACAACATAAT
GCTGGGTTGACTGGTTCTCATCCTTATGCCAGTACACCCATCAACTGGCCCTTCTCTTTGACTGGTATTAGCTTC
TGGACCGAAAATGACTCCCAGAAACAAATTTATCTTGTTGGAAATTTGCTCGGTTGGTGGGCATGTGTGGTCGGG
TTGTCAATCTACATTGGTATTCTTGGAGCCGACCTTATAGCGAGGCGTCGTGGCTTGGATCCTATCGCTGATCGT
AAGTACTGCTTGTTGCCAGCCAGTAGGTCGCTCATTAAACTGTTGCAGCTGTTCGCAACCGTCTATGGAACAACA
CTGGTTTCTTCATGCTCGTGTGGGCTGTCCACTACCTTCCGTTCTTCTTGTTCAGCCGCCAGCTTTTCATCCATC
ACTACCTTCCTTCGCACCTTGCCTCTGCTATGATTGCGGGCTCGGTTTTGAGCTTTATTCTTAGCGATACTATTA
ATTTCCCTATCTCCCTCCGTGGACCGAAGACAAGGCCTCAGACTACTCAATATGCTGACGTTGGAACAAAGGGTG
TTGTTACTACTGTGATCTTCAGTCTTGTGATGTTTGTGATGTTCTCATACATGGCACCTTTGACGTATGGCTCTC
CTGGGTAGGTTCTTGTGCAGTGATTGTCAAATTATCTATGCTTAATATCTTCTTTTTTTAGACTGACGGGCGAAG
AAGTCAATAGCAGAAGACTTTTGTCGACCTGGACTCTCCATTTTGCGGCTAAAAAGACATATGATGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail