Agaricus bisporus var burnettii H119p4

General Properties

Protein ID	Agabi119p4\|092460
Gene name
Location	scaffold_06:1080691..1082666
Strand	+
Gene length (bp)	1975
Transcript length (bp)	1554
Coding sequence length (bp)	1554
Protein length (aa)	518

PFAM Domains

PFAM Domain ID	Short name	Long name	E-value	Start	End
PF00400	WD40	WD domain, G-beta repeat	2.9E-04	176	201
PF00400	WD40	WD domain, G-beta repeat	3.8E-04	207	251
PF00400	WD40	WD domain, G-beta repeat	2.3E-08	256	293
PF00400	WD40	WD domain, G-beta repeat	1.3E-03	304	335
PF00400	WD40	WD domain, G-beta repeat	2.4E-07	343	377
PF08799	PRP4	pre-mRNA processing factor 4 (PRP4) like	7.2E-13	50	76

Swissprot hits

[Show all]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|O43172\|PRP4_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2	28	516	7.0E-129
sp\|Q3MHE2\|PRP4_BOVIN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1	28	516	6.0E-128
sp\|Q9DAW6\|PRP4_MOUSE	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1	28	516	6.0E-128
sp\|Q5NVD0\|PRP4_PONAB	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1	28	516	1.0E-127
sp\|Q9UTC7\|YIDC_SCHPO	Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1	17	515	3.0E-119

[Show all]

[Show less]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|O43172\|PRP4_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2	28	516	7.0E-129
sp\|Q3MHE2\|PRP4_BOVIN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1	28	516	6.0E-128
sp\|Q9DAW6\|PRP4_MOUSE	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1	28	516	6.0E-128
sp\|Q5NVD0\|PRP4_PONAB	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1	28	516	1.0E-127
sp\|Q9UTC7\|YIDC_SCHPO	Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1	17	515	3.0E-119
sp\|O22212\|PRP4L_ARATH	U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1	18	514	1.0E-96
sp\|P20053\|PRP4_YEAST	U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1	28	513	3.0E-75
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	181	513	5.0E-48
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	176	513	1.0E-43
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	171	513	8.0E-43
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	171	514	2.0E-41
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	159	399	5.0E-41
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	179	513	8.0E-41
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	171	485	2.0E-40
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	176	389	2.0E-40
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	164	513	1.0E-39
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	171	513	1.0E-38
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	176	513	1.0E-37
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	171	513	3.0E-37
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	179	513	5.0E-37
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	176	399	5.0E-37
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	175	513	9.0E-37
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	161	513	7.0E-36
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	176	513	1.0E-35
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	171	517	4.0E-35
sp\|Q8N136\|DAW1_HUMAN	Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1	175	513	8.0E-35
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	173	471	1.0E-34
sp\|Q5M786\|WDR5_XENTR	WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1	171	390	2.0E-34
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	175	513	2.0E-34
sp\|Q498M4\|WDR5_RAT	WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1	171	390	3.0E-34
sp\|P61965\|WDR5_MOUSE	WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1	171	390	3.0E-34
sp\|P61964\|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1	171	390	3.0E-34
sp\|Q5BK30\|DAW1_RAT	Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1	132	513	6.0E-34
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	176	380	1.0E-33
sp\|Q54KL5\|WDR5_DICDI	WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1	171	390	1.0E-33
sp\|Q9V3J8\|WDS_DROME	Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1	171	390	2.0E-33
sp\|Q5RE95\|WDR5B_PONAB	WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1	170	390	2.0E-33
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	158	513	3.0E-33
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	176	387	1.0E-32
sp\|Q9D7H2\|WDR5B_MOUSE	WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1	171	390	1.0E-32
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	175	513	1.0E-32
sp\|Q86VZ2\|WDR5B_HUMAN	WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1	170	390	2.0E-32
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	171	513	3.0E-32
sp\|Q4V8C4\|WDR5B_RAT	WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1	171	390	3.0E-32
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	170	379	5.0E-32
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	175	399	7.0E-32
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	175	513	7.0E-32
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	171	411	9.0E-32
sp\|Q10051\|PRP19_CAEEL	Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2	190	386	9.0E-32
sp\|Q6S7B0\|TAF5_ARATH	Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1	170	406	4.0E-31
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	247	513	5.0E-31
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	171	399	5.0E-31
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	175	513	5.0E-31
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	232	504	2.0E-29
sp\|Q9BVA0\|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1	187	399	3.0E-29
sp\|Q8BG40\|KTNB1_MOUSE	Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1	187	399	3.0E-29
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	171	438	5.0E-29
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	187	384	5.0E-29
sp\|A8X8C6\|TG125_CAEBR	WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1	171	393	7.0E-29
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	151	386	8.0E-29
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	150	376	1.0E-28
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	232	509	1.0E-28
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	173	399	2.0E-28
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	151	377	3.0E-28
sp\|O13282\|TAF5_SCHPO	Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1	181	401	5.0E-28
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	187	407	6.0E-28
sp\|Q8N136\|DAW1_HUMAN	Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1	171	376	7.0E-28
sp\|O13282\|TAF5_SCHPO	Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1	175	389	7.0E-28
sp\|Q8W1K8\|MUT11_CHLRE	Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1	158	377	7.0E-28
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	171	406	9.0E-28
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	137	394	2.0E-27
sp\|Q08E38\|PRP19_BOVIN	Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1	143	514	2.0E-27
sp\|Q9JMJ4\|PRP19_RAT	Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2	143	514	2.0E-27
sp\|Q99KP6\|PRP19_MOUSE	Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1	143	514	2.0E-27
sp\|Q9UMS4\|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1	143	514	3.0E-27
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	171	403	4.0E-27
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	173	399	5.0E-27
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	187	399	6.0E-27
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	176	387	6.0E-27
sp\|Q9M2Z2\|WDR5A_ARATH	COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1	171	406	7.0E-27
sp\|Q93847\|YZLL_CAEEL	Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1	173	390	7.0E-27
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	171	376	8.0E-27
sp\|O75529\|TAF5L_HUMAN	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1	171	406	8.0E-27
sp\|Q5ZMA2\|PRP19_CHICK	Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1	182	514	2.0E-26
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	187	384	3.0E-26
sp\|C4Q0P6\|LIS1_SCHMA	Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1	171	399	5.0E-26
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	160	397	5.0E-26
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	187	407	6.0E-26
sp\|B3S4I5\|LIS1_TRIAD	Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1	171	473	6.0E-26
sp\|A8XZJ9\|LIS1_CAEBR	Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2	128	419	1.0E-25
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	166	383	2.0E-25
sp\|Q9BVA0\|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1	160	376	2.0E-25
sp\|Q8BG40\|KTNB1_MOUSE	Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1	160	376	2.0E-25
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	209	514	2.0E-25
sp\|Q90ZL4\|LIS1_XENLA	Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3	71	473	2.0E-25
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	171	399	3.0E-25
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	187	407	3.0E-25
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	170	399	3.0E-25
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	209	504	3.0E-25
sp\|Q9SY00\|WDR5B_ARATH	COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1	161	397	4.0E-25
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	172	507	4.0E-25
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	172	507	4.0E-25
sp\|Q9AV81\|PRP19_ORYSJ	Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1	176	513	5.0E-25
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	171	376	6.0E-25
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	206	406	7.0E-25
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	171	399	7.0E-25
sp\|C3XVT5\|LIS1_BRAFL	Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1	171	390	7.0E-25
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	253	513	1.0E-24
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	171	399	1.0E-24
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	171	391	1.0E-24
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	206	406	2.0E-24
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	160	397	2.0E-24
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	238	507	2.0E-24
sp\|A2CEH0\|POC1B_DANRE	POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1	171	504	2.0E-24
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	171	473	2.0E-24
sp\|O43017\|SWD3_SCHPO	Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1	150	392	2.0E-24
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	171	473	2.0E-24
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	171	473	2.0E-24
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	171	473	2.0E-24
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	171	399	2.0E-24
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	171	473	2.0E-24
sp\|Q4V7Z1\|POC1B_XENLA	POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1	209	504	2.0E-24
sp\|Q8W1K8\|MUT11_CHLRE	Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1	205	387	3.0E-24
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	171	473	3.0E-24
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	172	507	3.0E-24
sp\|Q9VZF4\|FBXW7_DROME	F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1	172	501	3.0E-24
sp\|Q93794\|SEL10_CAEEL	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3	184	509	4.0E-24
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	176	378	4.0E-24
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	171	406	4.0E-24
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	176	378	4.0E-24
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	209	440	4.0E-24
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	231	376	4.0E-24
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	231	376	4.0E-24
sp\|D3ZW91\|POC1B_RAT	POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1	171	504	4.0E-24
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	171	473	5.0E-24
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	171	473	5.0E-24
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	161	513	6.0E-24
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	151	376	6.0E-24
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	160	381	6.0E-24
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	171	474	6.0E-24
sp\|Q5BE22\|PRP46_EMENI	Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1	183	475	6.0E-24
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	171	473	6.0E-24
sp\|F6ZT52\|POC1B_XENTR	POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1	209	504	6.0E-24
sp\|Q54KL5\|WDR5_DICDI	WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1	210	509	7.0E-24
sp\|O76734\|TUP1_DICDI	General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1	150	404	7.0E-24
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	167	378	8.0E-24
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	171	399	9.0E-24
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	261	513	1.0E-23
sp\|Q54KL5\|WDR5_DICDI	WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1	171	390	1.0E-23
sp\|B8P4B0\|LIS11_POSPM	Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1	175	390	1.0E-23
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	171	473	1.0E-23
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	258	514	2.0E-23
sp\|B8PD53\|LIS12_POSPM	Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1	175	390	2.0E-23
sp\|P0CS42\|LIS1_CRYNJ	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1	175	390	2.0E-23
sp\|P0CS43\|LIS1_CRYNB	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1	175	390	2.0E-23
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	151	376	2.0E-23
sp\|Q9V3J8\|WDS_DROME	Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1	261	513	3.0E-23
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	151	376	3.0E-23
sp\|O45040\|GBB1_HOMAM	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1	209	513	3.0E-23
sp\|Q7T394\|LIS1A_DANRE	Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3	138	473	3.0E-23
sp\|A0CH87\|LIS12_PARTE	Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1	207	399	3.0E-23
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	171	406	4.0E-23
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	231	376	4.0E-23
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	224	513	5.0E-23
sp\|Q7T0P4\|POC1A_XENLA	POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2	170	406	6.0E-23
sp\|Q7T0P4\|POC1A_XENLA	POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2	209	504	6.0E-23
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	171	504	6.0E-23
sp\|Q8JZX3\|POC1A_MOUSE	POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2	209	504	6.0E-23
sp\|A0DB19\|LIS11_PARTE	Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1	207	400	6.0E-23
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	171	513	7.0E-23
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	231	376	8.0E-23
sp\|Q9UUG8\|TUP12_SCHPO	Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2	171	381	8.0E-23
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	171	471	9.0E-23
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	258	514	1.0E-22
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	171	474	1.0E-22
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	210	422	1.0E-22
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	167	390	1.0E-22
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	171	473	1.0E-22
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	187	376	1.0E-22
sp\|O22785\|PR19B_ARATH	Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3	184	513	1.0E-22
sp\|Q28YY2\|WDR48_DROPS	WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2	176	450	1.0E-22
sp\|B4GIJ0\|WDR48_DROPE	WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1	176	450	1.0E-22
sp\|Q5RE95\|WDR5B_PONAB	WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1	171	376	2.0E-22
sp\|Q86VZ2\|WDR5B_HUMAN	WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1	171	376	2.0E-22
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	170	406	2.0E-22
sp\|Q7T0P4\|POC1A_XENLA	POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2	171	474	2.0E-22
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	171	504	2.0E-22
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	176	397	2.0E-22
sp\|A8NEG8\|LIS1_COPC7	Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3	155	376	2.0E-22
sp\|C4Q0P6\|LIS1_SCHMA	Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1	210	513	3.0E-22
sp\|Q4P9P9\|LIS1_USTMA	Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1	171	399	3.0E-22
sp\|A8X8C6\|TG125_CAEBR	WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1	171	376	4.0E-22
sp\|Q23256\|WDR53_CAEEL	WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1	159	384	4.0E-22
sp\|Q4V8C4\|WDR5B_RAT	WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1	210	504	5.0E-22
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	179	424	5.0E-22
sp\|Q7ZVF0\|POC1A_DANRE	POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1	171	406	5.0E-22
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	261	516	6.0E-22
sp\|Q9UUG8\|TUP12_SCHPO	Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2	176	517	6.0E-22
sp\|Q7ZXK9\|NLE1_XENLA	Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1	231	376	6.0E-22
sp\|B4LQ21\|LIS1_DROVI	Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1	168	403	6.0E-22
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	171	399	7.0E-22
sp\|Q8JZX3\|POC1A_MOUSE	POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2	171	474	9.0E-22
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	176	394	9.0E-22
sp\|Q6P5M2\|WDR61_DANRE	WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1	171	399	9.0E-22
sp\|Q4V8C4\|WDR5B_RAT	WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1	181	376	1.0E-21
sp\|Q9SY00\|WDR5B_ARATH	COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1	207	498	1.0E-21
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	171	386	1.0E-21
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	171	474	1.0E-21
sp\|Q291L9\|LIS1_DROPS	Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1	168	403	1.0E-21
sp\|B4GAJ1\|LIS1_DROPE	Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1	168	403	1.0E-21
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	209	472	1.0E-21
sp\|Q4WT34\|PRP46_ASPFU	Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1	183	475	1.0E-21
sp\|B4KT48\|LIS1_DROMO	Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1	168	403	1.0E-21
sp\|O13615\|PRP46_SCHPO	Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1	200	394	1.0E-21
sp\|Q5M786\|WDR5_XENTR	WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1	203	504	2.0E-21
sp\|Q498M4\|WDR5_RAT	WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1	210	504	2.0E-21
sp\|Q498M4\|WDR5_RAT	WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1	171	376	2.0E-21
sp\|P61965\|WDR5_MOUSE	WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1	210	504	2.0E-21
sp\|P61965\|WDR5_MOUSE	WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1	171	376	2.0E-21
sp\|P61964\|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1	210	504	2.0E-21
sp\|P61964\|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1	171	376	2.0E-21
sp\|Q9M2Z2\|WDR5A_ARATH	COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1	186	514	2.0E-21
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	165	380	2.0E-21
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	209	504	2.0E-21
sp\|Q6PH57\|GBB1_DANRE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1	209	513	2.0E-21
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	124	376	2.0E-21
sp\|Q17N69\|LIS1_AEDAE	Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2	171	399	2.0E-21
sp\|B4QHG6\|LIS1_DROSI	Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1	168	403	2.0E-21
sp\|B4HSL3\|LIS1_DROSE	Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1	168	403	2.0E-21
sp\|Q7KNS3\|LIS1_DROME	Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2	168	403	2.0E-21
sp\|O43660\|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1	161	376	2.0E-21
sp\|Q8N136\|DAW1_HUMAN	Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1	258	514	3.0E-21
sp\|Q9D7H2\|WDR5B_MOUSE	WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1	210	504	3.0E-21
sp\|Q2KIG2\|WDR5_BOVIN	WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1	210	504	3.0E-21
sp\|Q2KIG2\|WDR5_BOVIN	WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1	171	376	3.0E-21
sp\|P46800\|GBLP_DICDI	Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2	207	397	3.0E-21
sp\|B4JWA1\|LIS1_DROGR	Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1	168	403	3.0E-21
sp\|C3XVT5\|LIS1_BRAFL	Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1	163	379	4.0E-21
sp\|P46800\|GBLP_DICDI	Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2	171	387	4.0E-21
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	161	376	4.0E-21
sp\|B4P6P9\|LIS1_DROYA	Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1	168	403	4.0E-21
sp\|B3NPW0\|LIS1_DROER	Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1	168	403	4.0E-21
sp\|O14170\|POP2_SCHPO	WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1	188	494	4.0E-21
sp\|P87053\|POF1_SCHPO	F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1	187	397	4.0E-21
sp\|Q61011\|GBB3_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2	209	513	5.0E-21
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	161	376	5.0E-21
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	176	407	5.0E-21
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	209	504	6.0E-21
sp\|Q61011\|GBB3_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2	171	472	6.0E-21
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	159	376	6.0E-21
sp\|Q96WV5\|COPA_SCHPO	Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1	179	407	6.0E-21
sp\|D3BUN1\|LIS1_POLPA	Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1	171	399	6.0E-21
sp\|P52287\|GBB3_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1	171	472	6.0E-21
sp\|Q23256\|WDR53_CAEEL	WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1	174	504	7.0E-21
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	176	346	8.0E-21
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	249	376	8.0E-21
sp\|Q86VZ2\|WDR5B_HUMAN	WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1	210	504	9.0E-21
sp\|C4Q0P6\|LIS1_SCHMA	Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1	163	379	9.0E-21
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	158	513	9.0E-21
sp\|P79147\|GBB3_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1	171	472	9.0E-21
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	176	450	9.0E-21
sp\|Q5M786\|WDR5_XENTR	WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1	171	376	1.0E-20
sp\|Q9M2Z2\|WDR5A_ARATH	COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1	159	376	1.0E-20
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	176	394	1.0E-20
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	176	394	1.0E-20
sp\|O13615\|PRP46_SCHPO	Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1	87	406	1.0E-20
sp\|P52287\|GBB3_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1	209	513	1.0E-20
sp\|P79147\|GBB3_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1	209	513	1.0E-20
sp\|B3MET8\|WDR48_DROAN	WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1	176	450	1.0E-20
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	176	450	1.0E-20
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	171	403	1.0E-20
sp\|B3NSK1\|WDR48_DROER	WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1	176	450	1.0E-20
sp\|B3MEY6\|LIS1_DROAN	Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1	168	403	1.0E-20
sp\|B4MY65\|LIS1_DROWI	Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1	168	403	1.0E-20
sp\|Q17963\|WDR51_CAEEL	WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1	141	376	1.0E-20
sp\|B4MFM2\|WDR48_DROVI	WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1	176	450	1.0E-20
sp\|O18640\|GBLP_DROME	Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2	171	384	1.0E-20
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	258	513	2.0E-20
sp\|Q9D7H2\|WDR5B_MOUSE	WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1	181	376	2.0E-20
sp\|B3S4I5\|LIS1_TRIAD	Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1	202	513	2.0E-20
sp\|Q17963\|WDR51_CAEEL	WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1	208	513	2.0E-20
sp\|P17343\|GBB1_CAEEL	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2	209	472	2.0E-20
sp\|Q61ZF6\|GBB1_CAEBR	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1	209	472	2.0E-20
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	176	450	2.0E-20
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	171	402	2.0E-20
sp\|P54313\|GBB2_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4	209	472	2.0E-20
sp\|P62880\|GBB2_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3	209	472	2.0E-20
sp\|P62879\|GBB2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3	209	472	2.0E-20
sp\|P11017\|GBB2_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3	209	472	2.0E-20
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	176	450	2.0E-20
sp\|Q94BR4\|PR19A_ARATH	Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana GN=PRP19A PE=1 SV=1	184	420	2.0E-20
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	171	380	2.0E-20
sp\|P62882\|GBB5_RAT	Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1	176	376	2.0E-20
sp\|P62881\|GBB5_MOUSE	Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1	176	376	2.0E-20
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	258	514	3.0E-20
sp\|Q9V3J8\|WDS_DROME	Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1	141	376	3.0E-20
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	159	367	3.0E-20
sp\|D3ZW91\|POC1B_RAT	POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1	170	406	3.0E-20
sp\|Q5BE22\|PRP46_EMENI	Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1	160	397	3.0E-20
sp\|O76734\|TUP1_DICDI	General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1	176	378	3.0E-20
sp\|Q5RDY7\|GBB5_PONAB	Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1	176	376	3.0E-20
sp\|Q6GMD2\|WDR61_XENLA	WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1	171	422	3.0E-20
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	176	450	3.0E-20
sp\|Q2HJH6\|SNR40_BOVIN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1	171	381	3.0E-20
sp\|Q80ZD0\|GBB5_TAMST	Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1	176	376	3.0E-20
sp\|P16520\|GBB3_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1	171	472	3.0E-20
sp\|Q6PNB6\|GBB5_RABIT	Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1	176	376	3.0E-20
sp\|Q5RE95\|WDR5B_PONAB	WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1	210	504	4.0E-20
sp\|A8X8C6\|TG125_CAEBR	WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1	208	504	4.0E-20
sp\|O75529\|TAF5L_HUMAN	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1	159	347	4.0E-20
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	170	406	4.0E-20
sp\|Q4WT34\|PRP46_ASPFU	Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1	203	397	4.0E-20
sp\|O14775\|GBB5_HUMAN	Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2	176	376	4.0E-20
sp\|C4JZS6\|LIS11_UNCRE	Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1	63	407	4.0E-20
sp\|B6HP56\|LIS11_PENRW	Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1	175	473	4.0E-20
sp\|Q6PE01\|SNR40_MOUSE	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1	171	381	4.0E-20
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	166	341	5.0E-20
sp\|Q96DI7\|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1	171	381	5.0E-20
sp\|A9V790\|LIS1_MONBE	Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1	171	407	5.0E-20
sp\|Q5GIS3\|GBB_PINFU	Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1	209	472	5.0E-20
sp\|F6ZT52\|POC1B_XENTR	POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1	171	406	6.0E-20
sp\|Q2HJH6\|SNR40_BOVIN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1	156	399	6.0E-20
sp\|Q6PE01\|SNR40_MOUSE	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1	156	399	6.0E-20
sp\|C5JD40\|LIS1_AJEDS	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1	175	415	6.0E-20
sp\|C5GVJ9\|LIS1_AJEDR	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1	175	415	6.0E-20
sp\|Q6C709\|PRP46_YARLI	Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2	209	394	6.0E-20
sp\|Q9V3J8\|WDS_DROME	Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1	203	503	7.0E-20
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	171	402	7.0E-20
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	154	384	7.0E-20
sp\|Q42384\|PRL1_ARATH	Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1	176	375	7.0E-20
sp\|P26308\|GBB1_DROME	Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1	209	513	7.0E-20
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	207	378	8.0E-20
sp\|Q8I0F4\|LIS1_DICDI	Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1	202	403	8.0E-20
sp\|Q5RF51\|SNR40_PONAB	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1	156	399	8.0E-20
sp\|P16520\|GBB3_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1	209	513	9.0E-20
sp\|Q96DI7\|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1	156	399	9.0E-20
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	181	406	9.0E-20
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	304	517	1.0E-19
sp\|A8NEG8\|LIS1_COPC7	Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3	171	399	1.0E-19
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	259	507	1.0E-19
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	171	378	1.0E-19
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	165	380	1.0E-19
sp\|P25387\|GBLP_CHLRE	Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1	171	380	1.0E-19
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	171	380	1.0E-19
sp\|D3TLL6\|LIS1_GLOMM	Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1	171	401	1.0E-19
sp\|A2CEH0\|POC1B_DANRE	POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1	176	376	2.0E-19
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	238	376	2.0E-19
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	170	406	2.0E-19
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	171	513	2.0E-19
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	173	406	2.0E-19
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	171	397	2.0E-19
sp\|C1GB49\|LIS1_PARBD	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1	175	405	2.0E-19
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	171	380	2.0E-19
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	176	406	2.0E-19
sp\|P56094\|TUP1_KLULA	General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2	176	405	2.0E-19
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	176	406	2.0E-19
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	176	406	2.0E-19
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	258	513	3.0E-19
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	171	401	3.0E-19
sp\|O43017\|SWD3_SCHPO	Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1	170	357	3.0E-19
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	162	376	3.0E-19
sp\|Q5RF51\|SNR40_PONAB	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1	171	381	3.0E-19
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	162	380	3.0E-19
sp\|C0S902\|LIS1_PARBP	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2	175	405	3.0E-19
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	162	380	3.0E-19
sp\|Q9C0J8\|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2	176	376	3.0E-19
sp\|Q5R5W8\|GBB1_PONAB	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3	209	472	3.0E-19
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	176	407	4.0E-19
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	149	514	4.0E-19
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	176	407	4.0E-19
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	165	386	4.0E-19
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	171	380	4.0E-19
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	162	380	4.0E-19
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	162	380	4.0E-19
sp\|Q61FW2\|SEL10_CAEBR	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1	184	501	4.0E-19
sp\|Q8K4P0\|WDR33_MOUSE	pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1	176	376	4.0E-19
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	123	334	5.0E-19
sp\|Q93847\|YZLL_CAEEL	Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1	260	513	5.0E-19
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	163	379	5.0E-19
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	171	380	5.0E-19
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	176	407	5.0E-19
sp\|B4KTK4\|CIAO1_DROMO	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1	171	375	5.0E-19
sp\|Q6TMK6\|GBB1_CRIGR	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3	209	472	5.0E-19
sp\|Q54YD8\|COPB2_DICDI	Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1	158	406	5.0E-19
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	176	407	5.0E-19
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	159	334	6.0E-19
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	170	471	6.0E-19
sp\|P0CS42\|LIS1_CRYNJ	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1	171	402	6.0E-19
sp\|P0CS43\|LIS1_CRYNB	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1	171	402	6.0E-19
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	165	380	6.0E-19
sp\|P54311\|GBB1_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4	209	472	6.0E-19
sp\|P62874\|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3	209	472	6.0E-19
sp\|P62873\|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3	209	472	6.0E-19
sp\|P62872\|GBB1_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3	209	472	6.0E-19
sp\|P62871\|GBB1_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3	209	472	6.0E-19
sp\|B4LJT7\|CIAO1_DROVI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1	171	375	6.0E-19
sp\|Q6PBD6\|WDR61_XENTR	WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1	171	422	6.0E-19
sp\|Q229Z6\|POC1_TETTS	POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1	170	406	6.0E-19
sp\|Q8N136\|DAW1_HUMAN	Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1	170	334	7.0E-19
sp\|P0CS47\|PFS2_CRYNB	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1	160	376	7.0E-19
sp\|P0CS46\|PFS2_CRYNJ	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1	160	376	7.0E-19
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	165	386	8.0E-19
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	176	406	8.0E-19
sp\|Q8L828\|COB23_ARATH	Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1	173	403	8.0E-19
sp\|Q8SQS4\|TAF5_ENCCU	Transcription initiation factor TFIID subunit 5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF5 PE=1 SV=1	138	377	8.0E-19
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	163	379	9.0E-19
sp\|P87053\|POF1_SCHPO	F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1	211	494	9.0E-19
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	276	504	1.0E-18
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	173	376	1.0E-18
sp\|C3XVT5\|LIS1_BRAFL	Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1	210	513	1.0E-18
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	163	379	1.0E-18
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	163	379	1.0E-18
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	163	379	1.0E-18
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	163	379	1.0E-18
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	163	379	1.0E-18
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	163	379	1.0E-18
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	144	513	1.0E-18
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	162	394	1.0E-18
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	202	513	1.0E-18
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	173	384	1.0E-18
sp\|Q4P9P9\|LIS1_USTMA	Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1	194	513	1.0E-18
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	196	376	1.0E-18
sp\|Q4WLM7\|LIS1_ASPFU	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1	171	415	1.0E-18
sp\|B0XM00\|LIS1_ASPFC	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1	171	415	1.0E-18
sp\|B7FNU7\|LIS1_PHATC	Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1	171	390	1.0E-18
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	171	380	1.0E-18
sp\|P79959\|GBB1_XENLA	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1	209	472	1.0E-18
sp\|Q39190\|PRL2_ARATH	Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2	161	371	1.0E-18
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	171	339	2.0E-18
sp\|Q6S7B0\|TAF5_ARATH	Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1	242	394	2.0E-18
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	276	504	2.0E-18
sp\|Q90ZL4\|LIS1_XENLA	Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3	163	379	2.0E-18
sp\|F6ZT52\|POC1B_XENTR	POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1	179	376	2.0E-18
sp\|A8NEG8\|LIS1_COPC7	Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3	202	513	2.0E-18
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	138	513	2.0E-18
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	202	513	2.0E-18
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	175	376	2.0E-18
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	212	513	2.0E-18
sp\|P23232\|GBB_LOLFO	Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1	209	472	2.0E-18
sp\|Q2UGU1\|LIS1_ASPOR	Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2	176	399	2.0E-18
sp\|B8N9H4\|LIS1_ASPFN	Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2	176	399	2.0E-18
sp\|D5GBI7\|LIS1_TUBMM	Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1	176	405	2.0E-18
sp\|P49026\|GBLP_TOBAC	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1	171	380	2.0E-18
sp\|A1DP19\|LIS1_NEOFI	Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1	171	449	2.0E-18
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	171	378	2.0E-18
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	171	378	2.0E-18
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	171	378	2.0E-18
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	171	378	2.0E-18
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	171	378	2.0E-18
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	171	378	2.0E-18
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	171	378	2.0E-18
sp\|P69104\|GBLP_TRYBR	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1	209	389	2.0E-18
sp\|P69103\|GBLP_TRYBB	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1	209	389	2.0E-18
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	171	378	2.0E-18
sp\|Q4V7A0\|WDR61_RAT	WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1	135	399	2.0E-18
sp\|Q05B17\|WDR48_XENTR	WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1	156	390	2.0E-18
sp\|P36408\|GBB_DICDI	Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1	171	472	2.0E-18
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	170	334	3.0E-18
sp\|O13282\|TAF5_SCHPO	Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1	171	336	3.0E-18
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	207	501	3.0E-18
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	163	379	3.0E-18
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	163	379	3.0E-18
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	209	504	3.0E-18
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	159	379	3.0E-18
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	163	379	3.0E-18
sp\|Q42384\|PRL1_ARATH	Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1	200	406	3.0E-18
sp\|C7Z6H2\|LIS1_NECH7	Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1	175	407	3.0E-18
sp\|P29387\|GBB4_MOUSE	Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4	171	472	3.0E-18
sp\|B3S4I5\|LIS1_TRIAD	Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1	171	379	4.0E-18
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	171	394	4.0E-18
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	171	376	4.0E-18
sp\|Q4P9P9\|LIS1_USTMA	Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1	151	402	4.0E-18
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	163	379	4.0E-18
sp\|Q6CJ50\|MDV1_KLULA	Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1	153	380	4.0E-18
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	166	386	4.0E-18
sp\|A8IZG4\|CIAO1_CHLRE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1	210	376	4.0E-18
sp\|Q20168\|COPB2_CAEEL	Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3	175	394	4.0E-18
sp\|P16649\|TUP1_YEAST	General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2	176	394	4.0E-18
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	184	399	4.0E-18
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	176	406	4.0E-18
sp\|O35353\|GBB4_RAT	Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4	171	472	4.0E-18
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	202	513	5.0E-18
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	202	513	5.0E-18
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	202	513	5.0E-18
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	202	513	5.0E-18
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	171	394	5.0E-18
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	171	394	5.0E-18
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	208	381	5.0E-18
sp\|Q9ERF3\|WDR61_MOUSE	WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1	135	399	5.0E-18
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	258	514	6.0E-18
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	202	513	6.0E-18
sp\|D3TLL6\|LIS1_GLOMM	Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1	151	379	6.0E-18
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	149	513	6.0E-18
sp\|Q5DFU0\|CIAO1_SCHJA	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1	173	474	6.0E-18
sp\|O54929\|WSB2_MOUSE	WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2	224	514	6.0E-18
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	202	513	7.0E-18
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	171	380	7.0E-18
sp\|O14435\|GBB_CRYPA	Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1	209	513	7.0E-18
sp\|Q9UTN4\|PFS2_SCHPO	Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1	173	376	7.0E-18
sp\|B5X3Z6\|LIS1A_SALSA	Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1	149	513	7.0E-18
sp\|Q6CKE8\|PRP46_KLULA	Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1	128	406	7.0E-18
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	202	513	8.0E-18
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	170	406	8.0E-18
sp\|Q229Z6\|POC1_TETTS	POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1	209	504	8.0E-18
sp\|Q7ZXK9\|NLE1_XENLA	Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1	144	513	9.0E-18
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	176	380	9.0E-18
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	176	380	9.0E-18
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	171	368	1.0E-17
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	202	513	1.0E-17
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	149	513	1.0E-17
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	144	513	1.0E-17
sp\|O14170\|POP2_SCHPO	WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1	183	399	1.0E-17
sp\|Q6C709\|PRP46_YARLI	Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2	171	372	1.0E-17
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	179	399	1.0E-17
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	259	516	1.0E-17
sp\|Q6PFM9\|WDR48_DANRE	WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2	156	390	1.0E-17
sp\|Q93134\|GBLP_BIOGL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1	171	378	1.0E-17
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	176	390	1.0E-17
sp\|A1CUD6\|LIS11_ASPCL	Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1	175	405	1.0E-17
sp\|A7RWD2\|CIAO1_NEMVE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1	211	404	1.0E-17
sp\|Q9P7I3\|MDV1_SCHPO	Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1	117	401	1.0E-17
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	159	379	2.0E-17
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	144	513	2.0E-17
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	202	513	2.0E-17
sp\|Q291L9\|LIS1_DROPS	Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1	202	513	2.0E-17
sp\|B4GAJ1\|LIS1_DROPE	Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1	202	513	2.0E-17
sp\|Q17N69\|LIS1_AEDAE	Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2	202	513	2.0E-17
sp\|B4QHG6\|LIS1_DROSI	Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1	202	513	2.0E-17
sp\|B4HSL3\|LIS1_DROSE	Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1	202	513	2.0E-17
sp\|Q7KNS3\|LIS1_DROME	Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2	202	513	2.0E-17
sp\|P87053\|POF1_SCHPO	F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1	260	507	2.0E-17
sp\|Q96WV5\|COPA_SCHPO	Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1	171	387	2.0E-17
sp\|D3BUN1\|LIS1_POLPA	Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1	202	403	2.0E-17
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	202	513	2.0E-17
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	211	516	2.0E-17
sp\|Q9UTN4\|PFS2_SCHPO	Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1	176	425	2.0E-17
sp\|B5X3Z6\|LIS1A_SALSA	Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1	163	379	2.0E-17
sp\|Q6NNP0\|ATG16_ARATH	Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1	173	389	2.0E-17
sp\|Q2TZG4\|PFS2_ASPOR	Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1	165	399	2.0E-17
sp\|B4JW81\|CIAO1_DROGR	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1	209	399	2.0E-17
sp\|Q5RAW8\|WDR48_PONAB	WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1	156	390	2.0E-17
sp\|Q32PG3\|WDR48_BOVIN	WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1	156	390	2.0E-17
sp\|Q9NYS7\|WSB2_HUMAN	WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1	231	514	2.0E-17
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	157	376	2.0E-17
sp\|P54319\|PLAP_RAT	Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3	206	400	2.0E-17
sp\|Q8TAF3\|WDR48_HUMAN	WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1	156	390	2.0E-17
sp\|Q4R2Z6\|WDR48_MACFA	WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1	156	390	2.0E-17
sp\|Q9C827\|COB22_ARATH	Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1	173	403	2.0E-17
sp\|Q8BH57\|WDR48_MOUSE	WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1	156	390	2.0E-17
sp\|Q5F3K4\|WDR48_CHICK	WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1	156	390	2.0E-17
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	171	378	2.0E-17
sp\|Q7RY30\|LIS11_NEUCR	Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2	63	426	2.0E-17
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	144	513	3.0E-17
sp\|B8PD53\|LIS12_POSPM	Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1	171	365	3.0E-17
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	171	394	3.0E-17
sp\|B4LQ21\|LIS1_DROVI	Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1	202	513	3.0E-17
sp\|B4KT48\|LIS1_DROMO	Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1	202	513	3.0E-17
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	176	390	3.0E-17
sp\|Q2HJH6\|SNR40_BOVIN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1	257	508	3.0E-17
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	163	379	3.0E-17
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	259	516	3.0E-17
sp\|Q39190\|PRL2_ARATH	Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2	200	394	3.0E-17
sp\|B4JW81\|CIAO1_DROGR	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1	171	375	3.0E-17
sp\|B7QKS1\|CIAO1_IXOSC	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1	162	474	3.0E-17
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	176	380	3.0E-17
sp\|Q12417\|PRP46_YEAST	Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1	132	407	3.0E-17
sp\|Q08706\|GBB_LYMST	Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1	209	472	3.0E-17
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	202	513	4.0E-17
sp\|Q7T394\|LIS1A_DANRE	Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3	163	379	4.0E-17
sp\|Q291L9\|LIS1_DROPS	Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1	151	379	4.0E-17
sp\|B4GAJ1\|LIS1_DROPE	Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1	151	379	4.0E-17
sp\|B4JWA1\|LIS1_DROGR	Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1	110	513	4.0E-17
sp\|B4P6P9\|LIS1_DROYA	Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1	202	513	4.0E-17
sp\|B3NPW0\|LIS1_DROER	Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1	202	513	4.0E-17
sp\|D3BUN1\|LIS1_POLPA	Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1	171	403	4.0E-17
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	149	513	4.0E-17
sp\|Q96DI7\|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1	257	387	4.0E-17
sp\|Q8I0F4\|LIS1_DICDI	Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1	171	379	4.0E-17
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	260	516	4.0E-17
sp\|B4KTK4\|CIAO1_DROMO	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1	209	399	4.0E-17
sp\|Q9Y263\|PLAP_HUMAN	Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2	206	400	4.0E-17
sp\|Q5VQ78\|COB21_ORYSJ	Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1	173	403	4.0E-17
sp\|A7EKM8\|LIS1_SCLS1	Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1	176	405	4.0E-17
sp\|P27612\|PLAP_MOUSE	Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4	206	400	4.0E-17
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	238	504	5.0E-17
sp\|Q7ZVF0\|POC1A_DANRE	POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1	176	376	5.0E-17
sp\|B3MEY6\|LIS1_DROAN	Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1	202	513	5.0E-17
sp\|Q6PE01\|SNR40_MOUSE	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1	257	387	5.0E-17
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	208	379	5.0E-17
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	208	379	5.0E-17
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	260	516	5.0E-17
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	260	516	5.0E-17
sp\|B4LJT7\|CIAO1_DROVI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1	209	399	5.0E-17
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	259	516	5.0E-17
sp\|B7FNU7\|LIS1_PHATC	Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1	202	513	5.0E-17
sp\|Q6H8D6\|COB23_ORYSJ	Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2	173	376	5.0E-17
sp\|Q54PE0\|PWP2_DICDI	Periodic tryptophan protein 2 homolog OS=Dictyostelium discoideum GN=pwp2 PE=3 SV=1	169	445	5.0E-17
sp\|Q9GZS3\|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1	171	399	5.0E-17
sp\|Q0V8J1\|WSB2_BOVIN	WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1	231	514	5.0E-17
sp\|Q6FJZ9\|PRP46_CANGA	Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1	238	397	5.0E-17
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	171	380	5.0E-17
sp\|Q32LN7\|WDR61_BOVIN	WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1	171	399	5.0E-17
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	184	379	6.0E-17
sp\|Q229Z6\|POC1_TETTS	POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1	171	509	6.0E-17
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	209	394	6.0E-17
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	184	482	6.0E-17
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	184	482	6.0E-17
sp\|Q23256\|WDR53_CAEEL	WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1	151	376	7.0E-17
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	208	379	7.0E-17
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	208	379	7.0E-17
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	213	513	7.0E-17
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	234	395	8.0E-17
sp\|D1ZEB4\|LIS11_SORMK	Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1	175	426	8.0E-17
sp\|Q7ZVF0\|POC1A_DANRE	POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1	209	513	9.0E-17
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	176	380	9.0E-17
sp\|B4JWA1\|LIS1_DROGR	Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1	151	379	9.0E-17
sp\|B4MY65\|LIS1_DROWI	Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1	151	379	9.0E-17
sp\|B8P4B0\|LIS11_POSPM	Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1	171	370	1.0E-16
sp\|B8PD53\|LIS12_POSPM	Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1	261	390	1.0E-16
sp\|B4LQ21\|LIS1_DROVI	Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1	151	379	1.0E-16
sp\|Q8I0F4\|LIS1_DICDI	Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1	171	403	1.0E-16
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	259	516	1.0E-16
sp\|Q6H8D5\|COB22_ORYSJ	Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1	173	376	1.0E-16
sp\|Q86TI4\|WDR86_HUMAN	WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3	176	394	1.0E-16
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	157	376	1.0E-16
sp\|Q75BY3\|PRP46_ASHGO	Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2	200	399	1.0E-16
sp\|Q55DA2\|CIAO1_DICDI	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1	216	415	1.0E-16
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	258	513	1.0E-16
sp\|B6GZD3\|LIS12_PENRW	Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1	176	443	1.0E-16
sp\|Q4I7X1\|PFS2_GIBZE	Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1	173	399	1.0E-16
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	255	397	2.0E-16
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	168	367	2.0E-16
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	259	407	2.0E-16
sp\|Q93847\|YZLL_CAEEL	Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1	141	380	2.0E-16
sp\|Q9UUG8\|TUP12_SCHPO	Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2	250	516	2.0E-16
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	171	396	2.0E-16
sp\|B4QHG6\|LIS1_DROSI	Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1	151	379	2.0E-16
sp\|B4HSL3\|LIS1_DROSE	Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1	151	379	2.0E-16
sp\|Q7KNS3\|LIS1_DROME	Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2	151	379	2.0E-16
sp\|B4P6P9\|LIS1_DROYA	Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1	151	379	2.0E-16
sp\|B3NPW0\|LIS1_DROER	Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1	151	379	2.0E-16
sp\|D3BUN1\|LIS1_POLPA	Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1	159	378	2.0E-16
sp\|A9V790\|LIS1_MONBE	Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1	202	476	2.0E-16
sp\|Q5RF51\|SNR40_PONAB	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1	257	513	2.0E-16
sp\|P25387\|GBLP_CHLRE	Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1	259	490	2.0E-16
sp\|P0CS46\|PFS2_CRYNJ	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1	168	399	2.0E-16
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	209	394	2.0E-16
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	184	471	2.0E-16
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	184	387	2.0E-16
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	260	516	2.0E-16
sp\|C5PFX0\|LIS1_COCP7	Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2	175	405	2.0E-16
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	175	376	2.0E-16
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	175	376	2.0E-16
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	175	376	2.0E-16
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	175	376	2.0E-16
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	175	376	2.0E-16
sp\|P25635\|PWP2_YEAST	Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2	171	406	2.0E-16
sp\|A0CH87\|LIS12_PARTE	Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1	171	399	3.0E-16
sp\|Q17N69\|LIS1_AEDAE	Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2	151	379	3.0E-16
sp\|P46800\|GBLP_DICDI	Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2	163	389	3.0E-16
sp\|D3TLL6\|LIS1_GLOMM	Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1	149	513	3.0E-16
sp\|P0CS47\|PFS2_CRYNB	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1	168	399	3.0E-16
sp\|P49026\|GBLP_TOBAC	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1	184	474	3.0E-16
sp\|P36408\|GBB_DICDI	Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1	209	513	3.0E-16
sp\|Q6CKE8\|PRP46_KLULA	Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1	184	378	3.0E-16
sp\|Q55DA2\|CIAO1_DICDI	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1	171	373	3.0E-16
sp\|Q9Y6I7\|WSB1_HUMAN	WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1	178	378	3.0E-16
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	188	390	3.0E-16
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	171	380	3.0E-16
sp\|P49177\|GBB_ARATH	Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1	171	407	3.0E-16
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	209	399	3.0E-16
sp\|A0DB19\|LIS11_PARTE	Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1	160	399	4.0E-16
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	264	515	4.0E-16
sp\|B4MY65\|LIS1_DROWI	Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1	110	513	4.0E-16
sp\|Q6P1V3\|WSB1_XENTR	WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1	178	378	4.0E-16
sp\|Q7RY68\|PFS2_NEUCR	Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2	173	397	4.0E-16
sp\|Q6BVZ3\|PFS2_DEBHA	Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2	162	422	4.0E-16
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	211	380	4.0E-16
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	202	513	5.0E-16
sp\|Q9C0J8\|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2	175	407	5.0E-16
sp\|P69104\|GBLP_TRYBR	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1	171	378	5.0E-16
sp\|P69103\|GBLP_TRYBB	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1	171	378	5.0E-16
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	209	387	5.0E-16
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	160	334	5.0E-16
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	209	399	5.0E-16
sp\|Q6FT96\|MDV1_CANGA	Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1	152	380	5.0E-16
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	209	399	5.0E-16
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	181	475	5.0E-16
sp\|C6HTE8\|LIS1_AJECH	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1	176	407	5.0E-16
sp\|C0NRC6\|LIS1_AJECG	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1	176	407	5.0E-16
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	178	378	5.0E-16
sp\|Q9W5Z5\|WSB1_TAKRU	WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1	178	392	5.0E-16
sp\|Q6GM65\|PLAP_XENLA	Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2	207	400	5.0E-16
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	184	379	6.0E-16
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	184	471	6.0E-16
sp\|Q0U1B1\|LIS1_PHANO	Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1	175	405	6.0E-16
sp\|Q6CGP9\|PFS2_YARLI	Polyadenylation factor subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFS2 PE=3 SV=1	174	383	6.0E-16
sp\|Q8W1K8\|MUT11_CHLRE	Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1	304	482	7.0E-16
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	163	379	7.0E-16
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	175	376	7.0E-16
sp\|B3MEY6\|LIS1_DROAN	Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1	151	379	7.0E-16
sp\|O54929\|WSB2_MOUSE	WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2	187	400	7.0E-16
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	188	380	7.0E-16
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	238	376	7.0E-16
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	171	375	7.0E-16
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	171	375	7.0E-16
sp\|Q5ZJH5\|WDR61_CHICK	WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1	171	399	7.0E-16
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	184	371	7.0E-16
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	166	296	8.0E-16
sp\|B4KT48\|LIS1_DROMO	Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1	151	379	8.0E-16
sp\|Q8K4P0\|WDR33_MOUSE	pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1	175	407	8.0E-16
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	184	378	8.0E-16
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	209	471	8.0E-16
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	209	471	8.0E-16
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	209	471	8.0E-16
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	209	471	8.0E-16
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	209	471	8.0E-16
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	209	471	8.0E-16
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	209	471	8.0E-16
sp\|Q6FJZ9\|PRP46_CANGA	Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1	184	376	8.0E-16
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	227	381	8.0E-16
sp\|Q9VU65\|POC1_DROME	POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1	171	399	8.0E-16
sp\|Q5M7T1\|CIAO1_RAT	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1	224	399	8.0E-16
sp\|P87060\|POP1_SCHPO	WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1	208	384	8.0E-16
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	184	379	9.0E-16
sp\|P29829\|GBB2_DROME	Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3	170	376	9.0E-16
sp\|Q5A7Q3\|PRP46_CANAL	Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1	239	398	9.0E-16
sp\|Q2HBX6\|LIS11_CHAGB	Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1	174	379	9.0E-16
sp\|B2VWG7\|LIS1_PYRTR	Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1	175	379	9.0E-16
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	170	332	1.0E-15
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	176	337	1.0E-15
sp\|B8P4B0\|LIS11_POSPM	Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1	261	390	1.0E-15
sp\|Q6P5M2\|WDR61_DANRE	WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1	212	513	1.0E-15
sp\|A9V790\|LIS1_MONBE	Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1	131	378	1.0E-15
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	261	504	1.0E-15
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	261	504	1.0E-15
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	261	504	1.0E-15
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	261	504	1.0E-15
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	261	504	1.0E-15
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	261	504	1.0E-15
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	261	504	1.0E-15
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	261	504	1.0E-15
sp\|Q0V8J1\|WSB2_BOVIN	WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1	187	378	1.0E-15
sp\|Q9CAA0\|COB21_ARATH	Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2	173	376	1.0E-15
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	209	399	1.0E-15
sp\|Q20636\|GBB2_CAEEL	Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2	176	376	1.0E-15
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	238	403	1.0E-15
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	185	390	1.0E-15
sp\|Q99KN2\|CIAO1_MOUSE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1	224	399	1.0E-15
sp\|B3MC74\|CIAO1_DROAN	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1	209	399	1.0E-15
sp\|Q00664\|LIS1_EMENI	Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1	158	407	1.0E-15
sp\|Q32PJ6\|CIAO1_BOVIN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1	224	399	1.0E-15
sp\|Q20059\|WDR48_CAEEL	WD repeat-containing protein 48 homolog OS=Caenorhabditis elegans GN=wdr-48 PE=1 SV=2	176	390	1.0E-15
sp\|Q10281\|GBLP_SCHPO	Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3	184	399	1.0E-15
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	181	390	1.0E-15
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	176	399	2.0E-15
sp\|O75529\|TAF5L_HUMAN	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1	232	513	2.0E-15
sp\|Q6P5M2\|WDR61_DANRE	WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1	179	378	2.0E-15
sp\|O18640\|GBLP_DROME	Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2	210	382	2.0E-15
sp\|P0CS47\|PFS2_CRYNB	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1	130	359	2.0E-15
sp\|P0CS46\|PFS2_CRYNJ	Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1	130	359	2.0E-15
sp\|A1DP19\|LIS1_NEOFI	Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1	138	469	2.0E-15
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	211	397	2.0E-15
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	211	397	2.0E-15
sp\|Q9NYS7\|WSB2_HUMAN	WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1	187	378	2.0E-15
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	171	375	2.0E-15
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	238	380	2.0E-15
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	171	394	2.0E-15
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	157	376	2.0E-15
sp\|Q16MY0\|WDR48_AEDAE	WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1	188	380	2.0E-15
sp\|Q6BU94\|PRP46_DEBHA	Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2	238	390	2.0E-15
sp\|Q6BU94\|PRP46_DEBHA	Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2	185	376	2.0E-15
sp\|P49178\|GBB_MAIZE	Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1	208	513	2.0E-15
sp\|O35142\|COPB2_RAT	Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3	175	376	2.0E-15
sp\|B3NQR5\|CIAO1_DROER	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1	209	399	2.0E-15
sp\|B8M0Q1\|LIS1_TALSN	Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1	179	399	2.0E-15
sp\|O80990\|CIA1_ARATH	Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2	207	432	2.0E-15
sp\|Q8RXA7\|SCD1_ARATH	DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1	190	399	2.0E-15
sp\|C5FWH1\|LIS1_ARTOC	Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1	149	378	2.0E-15
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	151	379	3.0E-15
sp\|Q6GMD2\|WDR61_XENLA	WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1	212	399	3.0E-15
sp\|Q6C709\|PRP46_YARLI	Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2	260	399	3.0E-15
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	264	513	3.0E-15
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	261	504	3.0E-15
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	164	399	3.0E-15
sp\|Q0U1B1\|LIS1_PHANO	Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1	149	469	3.0E-15
sp\|Q16MY0\|WDR48_AEDAE	WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1	237	390	3.0E-15
sp\|B4QFZ8\|CIAO1_DROSI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1	209	399	3.0E-15
sp\|A1C7E4\|SCONB_ASPCL	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1	171	397	3.0E-15
sp\|Q8VZS9\|FZR1_ARATH	Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1	146	378	3.0E-15
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	211	380	3.0E-15
sp\|B2AEZ5\|LIS11_PODAN	Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2	175	379	3.0E-15
sp\|B4HRQ6\|CIAO1_DROSE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1	209	399	3.0E-15
sp\|O76071\|CIAO1_HUMAN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1	224	399	3.0E-15
sp\|Q7K1Y4\|CIAO1_DROME	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1	209	399	3.0E-15
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	264	513	4.0E-15
sp\|Q5RDY7\|GBB5_PONAB	Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1	233	407	4.0E-15
sp\|Q8L828\|COB23_ARATH	Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1	176	399	4.0E-15
sp\|Q39190\|PRL2_ARATH	Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2	260	397	4.0E-15
sp\|Q5M7T1\|CIAO1_RAT	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1	171	375	4.0E-15
sp\|B4QFZ8\|CIAO1_DROSI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1	171	375	4.0E-15
sp\|Q5ZMC3\|WSDU1_CHICK	WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2	175	378	4.0E-15
sp\|B8NGT5\|SCONB_ASPFN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1	162	397	4.0E-15
sp\|Q17GR9\|CIAO1_AEDAE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1	208	399	4.0E-15
sp\|Q2UFN8\|SCONB_ASPOR	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1	162	397	4.0E-15
sp\|Q80ZD0\|GBB5_TAMST	Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1	233	407	5.0E-15
sp\|Q6PNB6\|GBB5_RABIT	Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1	233	407	5.0E-15
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	210	382	5.0E-15
sp\|A7RWD2\|CIAO1_NEMVE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1	171	375	5.0E-15
sp\|C5FWH1\|LIS1_ARTOC	Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1	176	405	5.0E-15
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	181	390	5.0E-15
sp\|Q54D08\|LST8_DICDI	Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1	175	358	5.0E-15
sp\|Q4ICM0\|LIS1_GIBZE	Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2	175	407	5.0E-15
sp\|P0CS42\|LIS1_CRYNJ	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1	261	513	6.0E-15
sp\|P0CS43\|LIS1_CRYNB	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1	261	513	6.0E-15
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	188	390	6.0E-15
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	209	513	6.0E-15
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	209	505	6.0E-15
sp\|Q6H8D6\|COB23_ORYSJ	Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2	179	399	6.0E-15
sp\|Q7K1Y4\|CIAO1_DROME	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1	171	375	6.0E-15
sp\|Q25189\|GBLP_HYDVU	Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1	210	471	6.0E-15
sp\|A2QCU8\|SCONB_ASPNC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1	185	363	6.0E-15
sp\|O14775\|GBB5_HUMAN	Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2	233	407	7.0E-15
sp\|Q6H8D5\|COB22_ORYSJ	Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1	176	399	7.0E-15
sp\|Q99KN2\|CIAO1_MOUSE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1	171	375	7.0E-15
sp\|B4HRQ6\|CIAO1_DROSE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1	171	375	7.0E-15
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	179	405	7.0E-15
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	209	387	8.0E-15
sp\|Q3ULA2\|FBW1A_MOUSE	F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2	187	378	8.0E-15
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	264	387	9.0E-15
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	264	387	9.0E-15
sp\|P62882\|GBB5_RAT	Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1	233	407	9.0E-15
sp\|Q8N9V3\|WSDU1_HUMAN	WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3	175	376	9.0E-15
sp\|A1CF18\|LIS12_ASPCL	Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1	176	399	9.0E-15
sp\|B2B766\|LIS12_PODAN	Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1	171	422	9.0E-15
sp\|Q0D0X6\|LIS1_ASPTN	Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1	176	407	9.0E-15
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	171	394	1.0E-14
sp\|P62881\|GBB5_MOUSE	Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1	233	407	1.0E-14
sp\|Q05B17\|WDR48_XENTR	WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1	176	380	1.0E-14
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	172	388	1.0E-14
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	210	382	1.0E-14
sp\|D1ZEB4\|LIS11_SORMK	Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1	202	378	1.0E-14
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	152	339	1.0E-14
sp\|P87060\|POP1_SCHPO	WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1	186	376	1.0E-14
sp\|Q20636\|GBB2_CAEEL	Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2	188	407	1.0E-14
sp\|B3MC74\|CIAO1_DROAN	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1	171	375	1.0E-14
sp\|Q32PJ6\|CIAO1_BOVIN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1	171	375	1.0E-14
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	175	492	1.0E-14
sp\|B3NQR5\|CIAO1_DROER	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1	171	375	1.0E-14
sp\|O76071\|CIAO1_HUMAN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1	171	375	1.0E-14
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	173	387	1.0E-14
sp\|B0XAF3\|CIAO1_CULQU	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1	206	399	1.0E-14
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	175	492	1.0E-14
sp\|P93398\|GBB2_TOBAC	Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1	171	407	1.0E-14
sp\|P93563\|GBB_SOLTU	Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1	171	407	1.0E-14
sp\|Q10282\|GBB_SCHPO	Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2	228	473	1.0E-14
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	238	513	2.0E-14
sp\|O13282\|TAF5_SCHPO	Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1	268	504	2.0E-14
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	176	406	2.0E-14
sp\|C5JD40\|LIS1_AJEDS	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1	149	469	2.0E-14
sp\|C5GVJ9\|LIS1_AJEDR	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1	149	469	2.0E-14
sp\|Q2UGU1\|LIS1_ASPOR	Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2	184	399	2.0E-14
sp\|B8N9H4\|LIS1_ASPFN	Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2	184	399	2.0E-14
sp\|Q6PFM9\|WDR48_DANRE	WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2	176	380	2.0E-14
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	200	515	2.0E-14
sp\|B2VWG7\|LIS1_PYRTR	Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1	149	469	2.0E-14
sp\|Q9CAA0\|COB21_ARATH	Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2	176	399	2.0E-14
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	171	375	2.0E-14
sp\|Q10281\|GBLP_SCHPO	Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3	171	380	2.0E-14
sp\|P49178\|GBB_MAIZE	Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1	171	380	2.0E-14
sp\|B8NGT5\|SCONB_ASPFN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1	124	515	2.0E-14
sp\|Q2UFN8\|SCONB_ASPOR	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1	124	515	2.0E-14
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	187	376	2.0E-14
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	184	371	2.0E-14
sp\|O54927\|WSB1_MOUSE	WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1	178	378	2.0E-14
sp\|Q00659\|SCONB_EMENI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2	161	515	2.0E-14
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	171	397	2.0E-14
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	161	515	2.0E-14
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	171	397	2.0E-14
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	161	515	2.0E-14
sp\|Q91854\|TRCB_XENLA	Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1	187	378	2.0E-14
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	161	515	2.0E-14
sp\|D4DG66\|LIS1_TRIVH	Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1	176	407	2.0E-14
sp\|D4AZ50\|LIS1_ARTBC	Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1	176	407	2.0E-14
sp\|Q9Y297\|FBW1A_HUMAN	F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1	187	378	2.0E-14
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	238	397	3.0E-14
sp\|O43660\|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1	238	397	3.0E-14
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	238	406	3.0E-14
sp\|A8IZG4\|CIAO1_CHLRE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1	256	482	3.0E-14
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	171	380	3.0E-14
sp\|Q8BH57\|WDR48_MOUSE	WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1	176	380	3.0E-14
sp\|B6GZD3\|LIS12_PENRW	Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1	208	389	3.0E-14
sp\|P87060\|POP1_SCHPO	WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1	232	380	3.0E-14
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	184	380	3.0E-14
sp\|Q01369\|GBLP_NEUCR	Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1	210	390	3.0E-14
sp\|Q01369\|GBLP_NEUCR	Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1	171	373	3.0E-14
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	114	380	3.0E-14
sp\|P47025\|MDV1_YEAST	Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1	182	403	3.0E-14
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	208	399	3.0E-14
sp\|Q8VDD9\|PHIP_MOUSE	PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2	127	379	3.0E-14
sp\|Q8WWQ0\|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2	127	379	3.0E-14
sp\|P0CS42\|LIS1_CRYNJ	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1	151	376	4.0E-14
sp\|P0CS43\|LIS1_CRYNB	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1	151	376	4.0E-14
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	208	388	4.0E-14
sp\|Q5F3K4\|WDR48_CHICK	WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1	176	380	4.0E-14
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	171	375	4.0E-14
sp\|Q6CG48\|LIS1_YARLI	Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1	154	471	4.0E-14
sp\|Q12834\|CDC20_HUMAN	Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2	181	376	4.0E-14
sp\|O35242\|FAN_MOUSE	Protein FAN OS=Mus musculus GN=Nsmaf PE=1 SV=2	184	379	4.0E-14
sp\|A6ZQL5\|MDV1_YEAS7	Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1	182	403	4.0E-14
sp\|P93397\|GBB1_TOBAC	Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1	171	407	4.0E-14
sp\|A2QP30\|LIS1_ASPNC	Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1	176	399	4.0E-14
sp\|O48847\|LUH_ARATH	Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1	176	397	4.0E-14
sp\|P56094\|TUP1_KLULA	General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2	176	377	5.0E-14
sp\|Q5RAW8\|WDR48_PONAB	WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1	176	380	5.0E-14
sp\|Q32PG3\|WDR48_BOVIN	WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1	176	380	5.0E-14
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	175	517	5.0E-14
sp\|Q8TAF3\|WDR48_HUMAN	WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1	176	380	5.0E-14
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	114	380	5.0E-14
sp\|Q5H7C0\|CDC20_PIG	Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1	184	376	5.0E-14
sp\|B3RNR8\|CIAO1_TRIAD	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1	171	378	5.0E-14
sp\|Q6FJS0\|PFS2_CANGA	Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1	157	376	5.0E-14
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	184	471	6.0E-14
sp\|Q4R2Z6\|WDR48_MACFA	WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1	176	380	6.0E-14
sp\|Q9C827\|COB22_ARATH	Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1	197	375	6.0E-14
sp\|Q00659\|SCONB_EMENI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2	185	397	6.0E-14
sp\|P90917\|RBA1_CAEEL	Probable histone-binding protein rba-1 OS=Caenorhabditis elegans GN=rba-1 PE=3 SV=1	176	382	6.0E-14
sp\|Q59WJ4\|PFS2_CANAL	Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1	162	387	6.0E-14
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	209	471	7.0E-14
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	260	398	7.0E-14
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	260	398	7.0E-14
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	224	517	7.0E-14
sp\|Q40687\|GBB_ORYSJ	Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. japonica GN=RGB1 PE=1 SV=1	208	513	7.0E-14
sp\|B8AP31\|GBB_ORYSI	Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. indica GN=RGBB PE=2 SV=1	208	513	7.0E-14
sp\|B5X212\|CIO1B_SALSA	Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1	208	399	7.0E-14
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	295	513	8.0E-14
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	258	513	8.0E-14
sp\|O18640\|GBLP_DROME	Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2	261	504	8.0E-14
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	175	378	8.0E-14
sp\|C7Z6H2\|LIS1_NECH7	Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1	185	378	8.0E-14
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	210	394	8.0E-14
sp\|C4R6H3\|LIS1_PICPG	Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1	160	359	8.0E-14
sp\|Q0CY32\|SCONB_ASPTN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1	162	397	8.0E-14
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	175	378	9.0E-14
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	184	399	9.0E-14
sp\|Q7KWK5\|PRP19_DICDI	Pre-mRNA-processing factor 19 OS=Dictyostelium discoideum GN=prp19 PE=3 SV=1	182	472	9.0E-14
sp\|A8XZJ9\|LIS1_CAEBR	Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2	176	337	1.0E-13
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	260	399	1.0E-13
sp\|Q5BE22\|PRP46_EMENI	Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1	258	403	1.0E-13
sp\|O76734\|TUP1_DICDI	General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1	264	513	1.0E-13
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	261	505	1.0E-13
sp\|Q4WT34\|PRP46_ASPFU	Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1	258	403	1.0E-13
sp\|Q8L828\|COB23_ARATH	Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1	197	375	1.0E-13
sp\|Q93134\|GBLP_BIOGL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1	261	513	1.0E-13
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	172	416	1.0E-13
sp\|Q5ZJH5\|WDR61_CHICK	WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1	212	399	1.0E-13
sp\|Q8RXA7\|SCD1_ARATH	DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1	188	397	1.0E-13
sp\|A1CF18\|LIS12_ASPCL	Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1	210	378	1.0E-13
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	162	399	1.0E-13
sp\|B8M7Q5\|SCONB_TALSN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1	200	515	1.0E-13
sp\|B8M7Q5\|SCONB_TALSN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1	171	397	1.0E-13
sp\|Q6FLI3\|CAF4_CANGA	CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1	189	412	1.0E-13
sp\|D1ZEM6\|LIS12_SORMK	Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1	175	405	1.0E-13
sp\|Q7S7L4\|LIS12_NEUCR	Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2	175	405	1.0E-13
sp\|Q99M63\|SMU1_RAT	WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1	169	338	1.0E-13
sp\|Q6NRT3\|SMU1_XENLA	WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1	169	338	1.0E-13
sp\|Q3UKJ7\|SMU1_MOUSE	WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2	169	338	1.0E-13
sp\|Q2TAY7\|SMU1_HUMAN	WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2	169	338	1.0E-13
sp\|Q76B40\|SMU1_CRIGR	WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1	169	338	1.0E-13
sp\|Q2TBS9\|SMU1_BOVIN	WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1	169	338	1.0E-13
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	260	399	2.0E-13
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	166	377	2.0E-13
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	260	399	2.0E-13
sp\|Q23256\|WDR53_CAEEL	WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1	258	516	2.0E-13
sp\|O43660\|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1	260	513	2.0E-13
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	260	513	2.0E-13
sp\|Q96WV5\|COPA_SCHPO	Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1	215	406	2.0E-13
sp\|Q2HJH6\|SNR40_BOVIN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1	186	379	2.0E-13
sp\|Q6PE01\|SNR40_MOUSE	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1	186	379	2.0E-13
sp\|Q54YD8\|COPB2_DICDI	Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1	197	375	2.0E-13
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	175	378	2.0E-13
sp\|Q5VQ78\|COB21_ORYSJ	Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1	197	375	2.0E-13
sp\|Q6H8D6\|COB23_ORYSJ	Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2	176	375	2.0E-13
sp\|Q75BY3\|PRP46_ASHGO	Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2	45	378	2.0E-13
sp\|Q5A7Q3\|PRP46_CANAL	Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1	185	376	2.0E-13
sp\|B8M0Q1\|LIS1_TALSN	Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1	187	426	2.0E-13
sp\|B2AEZ5\|LIS11_PODAN	Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2	149	378	2.0E-13
sp\|Q91854\|TRCB_XENLA	Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1	184	399	2.0E-13
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	176	378	2.0E-13
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	166	377	2.0E-13
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	188	399	2.0E-13
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	166	377	2.0E-13
sp\|P41811\|COPB2_YEAST	Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1	151	371	2.0E-13
sp\|Q8L3Z8\|FZR2_ARATH	Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1	146	378	2.0E-13
sp\|Q5ZME8\|SMU1_CHICK	WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1	169	338	2.0E-13
sp\|Q758R7\|MDV1_ASHGO	Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1	154	380	2.0E-13
sp\|Q75AV4\|PFS2_ASHGO	Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1	153	387	2.0E-13
sp\|A4R3M4\|LIS1_MAGO7	Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3	176	405	2.0E-13
sp\|Q54Y96\|SMU1_DICDI	WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2	228	397	2.0E-13
sp\|B6QC56\|LIS11_TALMQ	Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1	176	399	2.0E-13
sp\|B6Q4Z5\|SCONB_TALMQ	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1	171	397	2.0E-13
sp\|Q6P4J8\|SMU1_XENTR	WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1	169	338	2.0E-13
sp\|Q62623\|CDC20_RAT	Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2	181	376	2.0E-13
sp\|B6GZA1\|SCONB_PENRW	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1	258	515	2.0E-13
sp\|Q921C3\|BRWD1_MOUSE	Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2	263	382	2.0E-13
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	261	505	3.0E-13
sp\|O18640\|GBLP_DROME	Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2	167	387	3.0E-13
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	210	471	3.0E-13
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	227	384	3.0E-13
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	258	390	3.0E-13
sp\|O74184\|WAT1_SCHPO	WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1	173	364	3.0E-13
sp\|Q4X1Y0\|PFS2_ASPFU	Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1	165	397	3.0E-13
sp\|O08653\|TEP1_RAT	Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1	179	407	3.0E-13
sp\|A2CEH0\|POC1B_DANRE	POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1	261	513	4.0E-13
sp\|Q96DI7\|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1	186	379	4.0E-13
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	260	490	4.0E-13
sp\|Q32LN7\|WDR61_BOVIN	WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1	184	399	4.0E-13
sp\|Q10281\|GBLP_SCHPO	Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3	170	378	4.0E-13
sp\|B5X212\|CIO1B_SALSA	Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1	169	375	4.0E-13
sp\|P41811\|COPB2_YEAST	Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1	176	399	4.0E-13
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	294	513	5.0E-13
sp\|Q93794\|SEL10_CAEEL	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3	250	399	5.0E-13
sp\|O22785\|PR19B_ARATH	Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3	166	395	5.0E-13
sp\|Q9GZS3\|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1	184	399	5.0E-13
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	209	389	5.0E-13
sp\|Q54D08\|LST8_DICDI	Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1	171	405	5.0E-13
sp\|Q10282\|GBB_SCHPO	Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2	242	514	5.0E-13
sp\|B6Q4Z5\|SCONB_TALMQ	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1	200	515	5.0E-13
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	171	302	6.0E-13
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	276	513	6.0E-13
sp\|A8XZJ9\|LIS1_CAEBR	Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2	151	379	6.0E-13
sp\|Q9VU65\|POC1_DROME	POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1	167	376	6.0E-13
sp\|P69104\|GBLP_TRYBR	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1	170	378	7.0E-13
sp\|P69103\|GBLP_TRYBB	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1	170	378	7.0E-13
sp\|A8IZG4\|CIAO1_CHLRE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1	174	373	7.0E-13
sp\|Q93134\|GBLP_BIOGL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1	210	399	7.0E-13
sp\|Q55DA2\|CIAO1_DICDI	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1	176	376	7.0E-13
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	172	386	7.0E-13
sp\|Q3ULA2\|FBW1A_MOUSE	F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2	184	399	7.0E-13
sp\|Q9Y297\|FBW1A_HUMAN	F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1	184	399	7.0E-13
sp\|Q91854\|TRCB_XENLA	Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1	166	378	8.0E-13
sp\|B8AP31\|GBB_ORYSI	Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. indica GN=RGBB PE=2 SV=1	171	380	8.0E-13
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	176	376	9.0E-13
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	260	473	9.0E-13
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	197	384	9.0E-13
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	153	325	1.0E-12
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	260	513	1.0E-12
sp\|Q8I0F4\|LIS1_DICDI	Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1	170	337	1.0E-12
sp\|Q5RF51\|SNR40_PONAB	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1	186	379	1.0E-12
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	215	426	1.0E-12
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	215	389	1.0E-12
sp\|Q61FW2\|SEL10_CAEBR	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1	259	513	1.0E-12
sp\|A8IZG4\|CIAO1_CHLRE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1	166	380	1.0E-12
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	211	475	1.0E-12
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	211	475	1.0E-12
sp\|A7RWD2\|CIAO1_NEMVE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1	261	424	1.0E-12
sp\|Q6H8D5\|COB22_ORYSJ	Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1	176	375	1.0E-12
sp\|Q4I7X1\|PFS2_GIBZE	Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1	163	376	1.0E-12
sp\|Q7RY68\|PFS2_NEUCR	Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2	163	376	1.0E-12
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	217	415	1.0E-12
sp\|B3NQR5\|CIAO1_DROER	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1	260	473	1.0E-12
sp\|Q3ULA2\|FBW1A_MOUSE	F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2	166	388	1.0E-12
sp\|Q8N9V3\|WSDU1_HUMAN	WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3	176	449	1.0E-12
sp\|A1CF18\|LIS12_ASPCL	Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1	256	397	1.0E-12
sp\|B0XAF3\|CIAO1_CULQU	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1	171	375	1.0E-12
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	238	503	1.0E-12
sp\|Q6CG48\|LIS1_YARLI	Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1	151	376	1.0E-12
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	264	513	2.0E-12
sp\|Q20168\|COPB2_CAEEL	Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3	176	399	2.0E-12
sp\|Q6PFM9\|WDR48_DANRE	WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2	227	401	2.0E-12
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	211	475	2.0E-12
sp\|Q2HBX6\|LIS11_CHAGB	Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1	202	378	2.0E-12
sp\|Q10281\|GBLP_SCHPO	Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3	259	513	2.0E-12
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	264	513	2.0E-12
sp\|Q4ICM0\|LIS1_GIBZE	Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2	185	378	2.0E-12
sp\|Q9Y297\|FBW1A_HUMAN	F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1	166	378	2.0E-12
sp\|Q6FJS0\|PFS2_CANGA	Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1	224	514	2.0E-12
sp\|B5X212\|CIO1B_SALSA	Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1	179	376	2.0E-12
sp\|Q54Y96\|SMU1_DICDI	WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2	271	399	2.0E-12
sp\|B6GZA1\|SCONB_PENRW	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1	185	370	2.0E-12
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	287	513	3.0E-12
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	258	421	3.0E-12
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	215	389	3.0E-12
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	215	389	3.0E-12
sp\|Q9NYS7\|WSB2_HUMAN	WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1	171	384	3.0E-12
sp\|Q5F3K4\|WDR48_CHICK	WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1	227	401	3.0E-12
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	175	517	3.0E-12
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	260	399	3.0E-12
sp\|B4QFZ8\|CIAO1_DROSI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1	261	473	3.0E-12
sp\|Q7K1Y4\|CIAO1_DROME	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1	261	473	3.0E-12
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	258	517	3.0E-12
sp\|Q6FJS0\|PFS2_CANGA	Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1	155	380	3.0E-12
sp\|Q5ZMA2\|PRP19_CHICK	Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1	166	375	4.0E-12
sp\|D3BUN1\|LIS1_POLPA	Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1	305	404	4.0E-12
sp\|Q8I0F4\|LIS1_DICDI	Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1	299	404	4.0E-12
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	260	399	4.0E-12
sp\|Q17GR9\|CIAO1_AEDAE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1	171	375	4.0E-12
sp\|Q01369\|GBLP_NEUCR	Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1	170	380	4.0E-12
sp\|Q05B17\|WDR48_XENTR	WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1	227	401	5.0E-12
sp\|Q32LN7\|WDR61_BOVIN	WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1	212	399	5.0E-12
sp\|A1CF18\|LIS12_ASPCL	Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1	187	378	5.0E-12
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	259	400	6.0E-12
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	211	334	6.0E-12
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	141	336	6.0E-12
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	141	336	6.0E-12
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	215	475	6.0E-12
sp\|A4R3M4\|LIS1_MAGO7	Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3	149	378	6.0E-12
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	186	334	7.0E-12
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	260	513	7.0E-12
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	149	304	7.0E-12
sp\|B6QC56\|LIS11_TALMQ	Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1	171	378	7.0E-12
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	170	378	8.0E-12
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	260	513	8.0E-12
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	176	410	8.0E-12
sp\|Q2HBX6\|LIS11_CHAGB	Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1	185	399	8.0E-12
sp\|A1C7E4\|SCONB_ASPCL	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1	179	515	8.0E-12
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	215	389	9.0E-12
sp\|Q4I7X1\|PFS2_GIBZE	Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1	176	373	9.0E-12
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	159	376	9.0E-12
sp\|Q08E38\|PRP19_BOVIN	Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1	166	378	1.0E-11
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	234	513	1.0E-11
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	305	504	1.0E-11
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	171	336	1.0E-11
sp\|Q5DFU0\|CIAO1_SCHJA	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1	207	406	1.0E-11
sp\|B2AEZ5\|LIS11_PODAN	Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2	185	378	1.0E-11
sp\|B4HRQ6\|CIAO1_DROSE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1	261	473	1.0E-11
sp\|Q5ZMC3\|WSDU1_CHICK	WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2	206	513	1.0E-11
sp\|B2B766\|LIS12_PODAN	Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1	151	378	1.0E-11
sp\|Q0D0X6\|LIS1_ASPTN	Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1	151	399	1.0E-11
sp\|Q0CY32\|SCONB_ASPTN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1	238	515	1.0E-11
sp\|P41811\|COPB2_YEAST	Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1	173	391	1.0E-11
sp\|B6QC56\|LIS11_TALMQ	Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1	149	381	1.0E-11
sp\|Q921C3\|BRWD1_MOUSE	Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2	170	493	1.0E-11
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	296	504	2.0E-11
sp\|Q93134\|GBLP_BIOGL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1	170	378	2.0E-11
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	238	512	2.0E-11
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	141	336	2.0E-11
sp\|Q9GZS3\|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1	212	399	2.0E-11
sp\|Q86TI4\|WDR86_HUMAN	WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3	187	397	2.0E-11
sp\|B6GZD3\|LIS12_PENRW	Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1	256	397	2.0E-11
sp\|B6GZD3\|LIS12_PENRW	Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1	155	359	2.0E-11
sp\|Q9CAA0\|COB21_ARATH	Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2	197	417	2.0E-11
sp\|Q16MY0\|WDR48_AEDAE	WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1	234	394	2.0E-11
sp\|O80990\|CIA1_ARATH	Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2	174	375	2.0E-11
sp\|A2QCU8\|SCONB_ASPNC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1	178	515	2.0E-11
sp\|D1ZEM6\|LIS12_SORMK	Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1	149	378	2.0E-11
sp\|Q7S7L4\|LIS12_NEUCR	Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2	211	378	2.0E-11
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	281	513	3.0E-11
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	210	397	3.0E-11
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	171	487	3.0E-11
sp\|C5PFX0\|LIS1_COCP7	Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2	261	436	3.0E-11
sp\|B3MC74\|CIAO1_DROAN	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1	260	515	3.0E-11
sp\|Q99M63\|SMU1_RAT	WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1	232	515	3.0E-11
sp\|Q3UKJ7\|SMU1_MOUSE	WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2	232	515	3.0E-11
sp\|Q2TAY7\|SMU1_HUMAN	WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2	232	515	3.0E-11
sp\|Q76B40\|SMU1_CRIGR	WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1	232	515	3.0E-11
sp\|Q2TBS9\|SMU1_BOVIN	WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1	232	515	3.0E-11
sp\|Q5ZME8\|SMU1_CHICK	WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1	232	515	3.0E-11
sp\|P54313\|GBB2_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4	261	513	4.0E-11
sp\|P62880\|GBB2_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3	261	513	4.0E-11
sp\|P62879\|GBB2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3	261	513	4.0E-11
sp\|P11017\|GBB2_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3	261	513	4.0E-11
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	260	504	4.0E-11
sp\|Q4WLM7\|LIS1_ASPFU	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1	260	391	4.0E-11
sp\|B0XM00\|LIS1_ASPFC	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1	260	391	4.0E-11
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	151	373	4.0E-11
sp\|Q6FLI3\|CAF4_CANGA	CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1	261	387	4.0E-11
sp\|Q75AV4\|PFS2_ASHGO	Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1	224	513	4.0E-11
sp\|Q9UMS4\|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1	166	378	5.0E-11
sp\|Q94BR4\|PR19A_ARATH	Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana GN=PRP19A PE=1 SV=1	166	432	5.0E-11
sp\|D5GBI7\|LIS1_TUBMM	Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1	260	397	5.0E-11
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	176	373	5.0E-11
sp\|Q54Y96\|SMU1_DICDI	WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2	312	483	5.0E-11
sp\|B6Q4Z5\|SCONB_TALMQ	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1	184	380	5.0E-11
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	247	389	6.0E-11
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	208	389	6.0E-11
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	260	473	6.0E-11
sp\|O08653\|TEP1_RAT	Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1	176	510	6.0E-11
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	141	306	7.0E-11
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	166	292	7.0E-11
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	176	326	7.0E-11
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	176	373	7.0E-11
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	176	373	7.0E-11
sp\|O35142\|COPB2_RAT	Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3	176	373	7.0E-11
sp\|Q8N9V3\|WSDU1_HUMAN	WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3	238	513	7.0E-11
sp\|Q01369\|GBLP_NEUCR	Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1	304	504	7.0E-11
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	287	513	8.0E-11
sp\|C1GB49\|LIS1_PARBD	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1	260	397	8.0E-11
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	176	373	8.0E-11
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	176	373	8.0E-11
sp\|C6HTE8\|LIS1_AJECH	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1	252	406	8.0E-11
sp\|C6HTE8\|LIS1_AJECH	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1	171	378	8.0E-11
sp\|C0NRC6\|LIS1_AJECG	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1	252	406	8.0E-11
sp\|C0NRC6\|LIS1_AJECG	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1	171	378	8.0E-11
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	264	513	8.0E-11
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	176	380	8.0E-11
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	176	380	8.0E-11
sp\|C0S902\|LIS1_PARBP	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2	260	397	9.0E-11
sp\|Q8L828\|COB23_ARATH	Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1	209	492	9.0E-11
sp\|B4JW81\|CIAO1_DROGR	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1	260	513	9.0E-11
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	208	390	9.0E-11
sp\|Q00664\|LIS1_EMENI	Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1	151	399	9.0E-11
sp\|A0CH87\|LIS12_PARTE	Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1	304	499	1.0E-10
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	166	292	1.0E-10
sp\|P25387\|GBLP_CHLRE	Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1	170	378	1.0E-10
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	260	490	1.0E-10
sp\|P56094\|TUP1_KLULA	General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2	171	376	1.0E-10
sp\|B7FNU7\|LIS1_PHATC	Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1	211	336	1.0E-10
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	260	490	1.0E-10
sp\|Q20168\|COPB2_CAEEL	Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3	197	375	1.0E-10
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	196	345	1.0E-10
sp\|Q86TI4\|WDR86_HUMAN	WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3	184	380	1.0E-10
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	157	399	1.0E-10
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	176	399	1.0E-10
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	176	399	1.0E-10
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	176	399	1.0E-10
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	176	399	1.0E-10
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	173	399	1.0E-10
sp\|Q6NRT3\|SMU1_XENLA	WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1	232	515	1.0E-10
sp\|Q6P4J8\|SMU1_XENTR	WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1	232	515	1.0E-10
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	112	292	2.0E-10
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	171	292	2.0E-10
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	261	490	2.0E-10
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	176	336	2.0E-10
sp\|A7EKM8\|LIS1_SCLS1	Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1	261	397	2.0E-10
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	176	399	2.0E-10
sp\|P93563\|GBB_SOLTU	Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1	176	387	2.0E-10
sp\|P47025\|MDV1_YEAST	Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1	259	513	2.0E-10
sp\|A6ZQL5\|MDV1_YEAS7	Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1	259	513	2.0E-10
sp\|Q6S7B0\|TAF5_ARATH	Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1	251	513	3.0E-10
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	186	334	3.0E-10
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	258	405	3.0E-10
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	149	293	3.0E-10
sp\|A4R3M4\|LIS1_MAGO7	Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3	252	397	3.0E-10
sp\|Q2UGU1\|LIS1_ASPOR	Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2	261	397	4.0E-10
sp\|B8N9H4\|LIS1_ASPFN	Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2	261	397	4.0E-10
sp\|A1CUD6\|LIS11_ASPCL	Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1	257	391	4.0E-10
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	174	378	4.0E-10
sp\|Q20059\|WDR48_CAEEL	WD repeat-containing protein 48 homolog OS=Caenorhabditis elegans GN=wdr-48 PE=1 SV=2	184	373	4.0E-10
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	176	345	4.0E-10
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	174	378	5.0E-10
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	174	378	5.0E-10
sp\|Q7RY68\|PFS2_NEUCR	Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2	224	401	5.0E-10
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	171	399	5.0E-10
sp\|P29829\|GBB2_DROME	Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3	209	471	5.0E-10
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	161	399	5.0E-10
sp\|A1C7E4\|SCONB_ASPCL	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1	176	380	5.0E-10
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	176	380	5.0E-10
sp\|B8M7Q5\|SCONB_TALSN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1	185	375	5.0E-10
sp\|Q75AV4\|PFS2_ASHGO	Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1	179	376	5.0E-10
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	215	406	6.0E-10
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	215	406	6.0E-10
sp\|Q7RY68\|PFS2_NEUCR	Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2	176	373	6.0E-10
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	176	346	6.0E-10
sp\|O43660\|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1	181	376	7.0E-10
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	258	405	7.0E-10
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	215	406	7.0E-10
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	170	378	7.0E-10
sp\|Q8VDD9\|PHIP_MOUSE	PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2	263	382	7.0E-10
sp\|Q8WWQ0\|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2	263	382	7.0E-10
sp\|Q8SQS4\|TAF5_ENCCU	Transcription initiation factor TFIID subunit 5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF5 PE=1 SV=1	211	399	8.0E-10
sp\|O62621\|COPB2_DROME	Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2	238	399	8.0E-10
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	238	390	8.0E-10
sp\|D1ZEM6\|LIS12_SORMK	Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1	257	391	8.0E-10
sp\|Q7S7L4\|LIS12_NEUCR	Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2	257	391	8.0E-10
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	181	376	9.0E-10
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	258	405	9.0E-10
sp\|Q6BU94\|PRP46_DEBHA	Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2	164	380	9.0E-10
sp\|D4DG66\|LIS1_TRIVH	Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1	260	397	9.0E-10
sp\|D4AZ50\|LIS1_ARTBC	Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1	260	397	9.0E-10
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	258	405	1.0E-09
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	170	378	1.0E-09
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	171	401	1.0E-09
sp\|B8NGT5\|SCONB_ASPFN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1	176	380	1.0E-09
sp\|Q2UFN8\|SCONB_ASPOR	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1	176	380	1.0E-09
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	279	516	2.0E-09
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	181	376	2.0E-09
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	260	471	2.0E-09
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	170	378	2.0E-09
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	260	471	2.0E-09
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	186	347	2.0E-09
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	175	376	2.0E-09
sp\|Q6FT96\|MDV1_CANGA	Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1	166	373	2.0E-09
sp\|Q9VU65\|POC1_DROME	POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1	261	512	2.0E-09
sp\|Q8BHB4\|WDR3_MOUSE	WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1	277	406	2.0E-09
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	260	495	2.0E-09
sp\|B2AEZ5\|LIS11_PODAN	Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2	261	397	2.0E-09
sp\|Q25189\|GBLP_HYDVU	Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1	158	336	2.0E-09
sp\|P93398\|GBB2_TOBAC	Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1	176	389	2.0E-09
sp\|B6QC56\|LIS11_TALMQ	Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1	261	406	2.0E-09
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	258	405	3.0E-09
sp\|Q6CJ50\|MDV1_KLULA	Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1	259	387	3.0E-09
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	305	504	3.0E-09
sp\|Q9C827\|COB22_ARATH	Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1	209	492	3.0E-09
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	209	492	3.0E-09
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	209	492	3.0E-09
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	209	492	3.0E-09
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	209	492	3.0E-09
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	209	505	3.0E-09
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	260	504	3.0E-09
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	151	335	3.0E-09
sp\|Q6CGP9\|PFS2_YARLI	Polyadenylation factor subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFS2 PE=3 SV=1	224	399	3.0E-09
sp\|O35142\|COPB2_RAT	Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3	209	492	3.0E-09
sp\|A2QP30\|LIS1_ASPNC	Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1	171	399	3.0E-09
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	159	297	4.0E-09
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	279	516	4.0E-09
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	176	339	4.0E-09
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	176	339	4.0E-09
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	176	339	4.0E-09
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	176	339	4.0E-09
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	176	339	4.0E-09
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	176	339	4.0E-09
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	176	339	4.0E-09
sp\|Q5VQ78\|COB21_ORYSJ	Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1	209	399	4.0E-09
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	166	299	4.0E-09
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	176	336	4.0E-09
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	179	394	4.0E-09
sp\|Q6BU94\|PRP46_DEBHA	Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2	258	397	4.0E-09
sp\|B8M0Q1\|LIS1_TALSN	Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1	261	397	4.0E-09
sp\|C5FWH1\|LIS1_ARTOC	Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1	260	397	4.0E-09
sp\|Q17GR9\|CIAO1_AEDAE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1	300	513	4.0E-09
sp\|B8AP31\|GBB_ORYSI	Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. indica GN=RGBB PE=2 SV=1	176	377	4.0E-09
sp\|Q54KL5\|WDR5_DICDI	WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1	304	513	5.0E-09
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	279	516	5.0E-09
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	181	376	5.0E-09
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	145	327	5.0E-09
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	170	471	5.0E-09
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	260	495	5.0E-09
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	278	513	5.0E-09
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	170	292	6.0E-09
sp\|P25635\|PWP2_YEAST	Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2	263	514	6.0E-09
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	179	390	6.0E-09
sp\|P93397\|GBB1_TOBAC	Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1	176	387	6.0E-09
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	176	339	7.0E-09
sp\|Q6CKE8\|PRP46_KLULA	Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1	176	376	7.0E-09
sp\|Q6CG48\|LIS1_YARLI	Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1	239	390	7.0E-09
sp\|Q0CY32\|SCONB_ASPTN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1	176	380	7.0E-09
sp\|Q5DFU0\|CIAO1_SCHJA	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1	212	376	8.0E-09
sp\|Q4ICM0\|LIS1_GIBZE	Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2	245	397	8.0E-09
sp\|A2QCU8\|SCONB_ASPNC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1	176	380	8.0E-09
sp\|Q99M63\|SMU1_RAT	WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1	302	493	8.0E-09
sp\|Q6NRT3\|SMU1_XENLA	WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1	305	493	8.0E-09
sp\|Q3UKJ7\|SMU1_MOUSE	WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2	305	493	8.0E-09
sp\|Q2TAY7\|SMU1_HUMAN	WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2	305	493	8.0E-09
sp\|Q76B40\|SMU1_CRIGR	WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1	305	493	8.0E-09
sp\|Q2TBS9\|SMU1_BOVIN	WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1	305	493	8.0E-09
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	304	513	9.0E-09
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	161	399	9.0E-09
sp\|B3RNR8\|CIAO1_TRIAD	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1	247	406	9.0E-09
sp\|Q0CY32\|SCONB_ASPTN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1	287	492	9.0E-09
sp\|Q5ZME8\|SMU1_CHICK	WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1	305	493	9.0E-09
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	173	334	1.0E-08
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	173	334	1.0E-08
sp\|F6ZT52\|POC1B_XENTR	POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1	304	513	1.0E-08
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	171	335	1.0E-08
sp\|Q6PH57\|GBB1_DANRE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1	171	335	1.0E-08
sp\|P87053\|POF1_SCHPO	F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1	187	376	1.0E-08
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	150	378	1.0E-08
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	170	378	1.0E-08
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	166	299	1.0E-08
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	260	508	1.0E-08
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	232	390	1.0E-08
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	168	381	1.0E-08
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	166	309	1.0E-08
sp\|Q9UNX4\|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1	277	406	1.0E-08
sp\|Q00659\|SCONB_EMENI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2	187	380	1.0E-08
sp\|O48847\|LUH_ARATH	Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1	157	387	1.0E-08
sp\|Q59WJ4\|PFS2_CANAL	Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1	224	399	1.0E-08
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	306	516	2.0E-08
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	306	516	2.0E-08
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	150	378	2.0E-08
sp\|B4MFM2\|WDR48_DROVI	WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1	150	378	2.0E-08
sp\|P54313\|GBB2_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4	171	335	2.0E-08
sp\|P62880\|GBB2_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3	171	335	2.0E-08
sp\|P62879\|GBB2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3	171	335	2.0E-08
sp\|P11017\|GBB2_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3	171	335	2.0E-08
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	151	343	2.0E-08
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	196	405	2.0E-08
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	196	405	2.0E-08
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	196	405	2.0E-08
sp\|P79959\|GBB1_XENLA	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1	176	335	2.0E-08
sp\|Q6FJZ9\|PRP46_CANGA	Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1	260	400	2.0E-08
sp\|Q5ZMC3\|WSDU1_CHICK	WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2	171	475	2.0E-08
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	166	268	2.0E-08
sp\|Q8VDD9\|PHIP_MOUSE	PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2	305	399	2.0E-08
sp\|Q758R7\|MDV1_ASHGO	Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1	258	387	2.0E-08
sp\|Q6P4J8\|SMU1_XENTR	WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1	305	493	2.0E-08
sp\|O08653\|TEP1_RAT	Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1	175	501	2.0E-08
sp\|B3MET8\|WDR48_DROAN	WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1	150	378	3.0E-08
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	151	343	3.0E-08
sp\|C7Z6H2\|LIS1_NECH7	Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1	252	397	3.0E-08
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	150	384	3.0E-08
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	260	495	3.0E-08
sp\|Q20636\|GBB2_CAEEL	Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2	207	406	3.0E-08
sp\|B0XAF3\|CIAO1_CULQU	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1	300	515	3.0E-08
sp\|Q8WWQ0\|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2	305	399	3.0E-08
sp\|Q9V3J8\|WDS_DROME	Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1	172	296	4.0E-08
sp\|P16520\|GBB3_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1	170	335	4.0E-08
sp\|B6HP56\|LIS11_PENRW	Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1	261	469	4.0E-08
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	171	339	4.0E-08
sp\|P49177\|GBB_ARATH	Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1	171	376	4.0E-08
sp\|Q16MY0\|WDR48_AEDAE	WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1	150	419	4.0E-08
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	168	381	4.0E-08
sp\|Q91854\|TRCB_XENLA	Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1	280	513	4.0E-08
sp\|Q12834\|CDC20_HUMAN	Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2	176	397	4.0E-08
sp\|Q62623\|CDC20_RAT	Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2	169	397	4.0E-08
sp\|Q5RE95\|WDR5B_PONAB	WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1	172	295	5.0E-08
sp\|Q86VZ2\|WDR5B_HUMAN	WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1	172	295	5.0E-08
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	150	378	5.0E-08
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	150	378	5.0E-08
sp\|P54311\|GBB1_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4	261	513	6.0E-08
sp\|P62874\|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3	261	513	6.0E-08
sp\|P62873\|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3	261	513	6.0E-08
sp\|P62872\|GBB1_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3	261	513	6.0E-08
sp\|P62871\|GBB1_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3	261	513	6.0E-08
sp\|P87060\|POP1_SCHPO	WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1	291	505	6.0E-08
sp\|Q32PJ6\|CIAO1_BOVIN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1	258	471	6.0E-08
sp\|Q5H7C0\|CDC20_PIG	Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1	169	397	6.0E-08
sp\|O45040\|GBB1_HOMAM	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1	171	335	7.0E-08
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	166	293	7.0E-08
sp\|Q6TMK6\|GBB1_CRIGR	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3	261	513	7.0E-08
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	279	380	7.0E-08
sp\|Q5R5W8\|GBB1_PONAB	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3	261	513	8.0E-08
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	279	380	8.0E-08
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	170	378	8.0E-08
sp\|O43017\|SWD3_SCHPO	Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1	305	482	9.0E-08
sp\|Q6PBD6\|WDR61_XENTR	WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1	294	513	9.0E-08
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	121	310	9.0E-08
sp\|P90917\|RBA1_CAEEL	Probable histone-binding protein rba-1 OS=Caenorhabditis elegans GN=rba-1 PE=3 SV=1	292	399	9.0E-08
sp\|O08653\|TEP1_RAT	Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1	171	378	9.0E-08
sp\|Q9AV81\|PRP19_ORYSJ	Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1	283	517	1.0E-07
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	304	513	1.0E-07
sp\|Q28YY2\|WDR48_DROPS	WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2	150	378	1.0E-07
sp\|B4GIJ0\|WDR48_DROPE	WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1	150	378	1.0E-07
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	261	513	1.0E-07
sp\|P52287\|GBB3_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1	170	335	1.0E-07
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	150	378	1.0E-07
sp\|P26308\|GBB1_DROME	Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1	168	335	1.0E-07
sp\|Q5R5W8\|GBB1_PONAB	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3	176	335	1.0E-07
sp\|Q6TMK6\|GBB1_CRIGR	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3	176	335	1.0E-07
sp\|P54311\|GBB1_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4	176	335	1.0E-07
sp\|P62874\|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3	176	335	1.0E-07
sp\|P62873\|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3	176	335	1.0E-07
sp\|P62872\|GBB1_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3	176	335	1.0E-07
sp\|P62871\|GBB1_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3	176	335	1.0E-07
sp\|Q54PE0\|PWP2_DICDI	Periodic tryptophan protein 2 homolog OS=Dictyostelium discoideum GN=pwp2 PE=3 SV=1	213	378	1.0E-07
sp\|Q5A7Q3\|PRP46_CANAL	Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1	176	339	1.0E-07
sp\|P49178\|GBB_MAIZE	Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1	171	376	1.0E-07
sp\|O76071\|CIAO1_HUMAN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1	258	471	1.0E-07
sp\|Q54D08\|LST8_DICDI	Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1	187	399	1.0E-07
sp\|P93397\|GBB1_TOBAC	Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1	171	376	1.0E-07
sp\|A2QP30\|LIS1_ASPNC	Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1	261	469	1.0E-07
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	278	513	1.0E-07
sp\|Q5H7C0\|CDC20_PIG	Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1	244	513	1.0E-07
sp\|Q5ZME8\|SMU1_CHICK	WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1	181	298	1.0E-07
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	304	513	2.0E-07
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	171	292	2.0E-07
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	262	510	2.0E-07
sp\|B3NSK1\|WDR48_DROER	WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1	150	378	2.0E-07
sp\|P17343\|GBB1_CAEEL	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2	171	335	2.0E-07
sp\|Q61ZF6\|GBB1_CAEBR	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1	171	335	2.0E-07
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	150	378	2.0E-07
sp\|Q5GIS3\|GBB_PINFU	Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1	171	335	2.0E-07
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	170	378	2.0E-07
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	279	399	2.0E-07
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	304	513	2.0E-07
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	211	390	2.0E-07
sp\|Q9W5Z5\|WSB1_TAKRU	WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1	290	513	2.0E-07
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	279	380	2.0E-07
sp\|Q99M63\|SMU1_RAT	WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1	181	298	2.0E-07
sp\|Q6NRT3\|SMU1_XENLA	WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1	181	298	2.0E-07
sp\|Q3UKJ7\|SMU1_MOUSE	WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2	181	298	2.0E-07
sp\|Q2TAY7\|SMU1_HUMAN	WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2	181	298	2.0E-07
sp\|Q76B40\|SMU1_CRIGR	WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1	181	298	2.0E-07
sp\|Q2TBS9\|SMU1_BOVIN	WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1	181	298	2.0E-07
sp\|Q6P4J8\|SMU1_XENTR	WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1	181	298	2.0E-07
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	171	334	3.0E-07
sp\|Q8I0F4\|LIS1_DICDI	Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1	344	513	3.0E-07
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	151	343	3.0E-07
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	176	376	3.0E-07
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	176	376	3.0E-07
sp\|Q5DFU0\|CIAO1_SCHJA	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1	124	328	3.0E-07
sp\|Q12417\|PRP46_YEAST	Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1	176	376	3.0E-07
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	279	399	3.0E-07
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	251	399	3.0E-07
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	149	334	3.0E-07
sp\|Q6CGP9\|PFS2_YARLI	Polyadenylation factor subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFS2 PE=3 SV=1	176	376	3.0E-07
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	280	513	3.0E-07
sp\|Q12834\|CDC20_HUMAN	Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2	246	513	3.0E-07
sp\|Q12834\|CDC20_HUMAN	Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2	171	334	3.0E-07
sp\|Q5H7C0\|CDC20_PIG	Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1	171	334	3.0E-07
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	171	295	4.0E-07
sp\|P79959\|GBB1_XENLA	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1	261	513	4.0E-07
sp\|O35353\|GBB4_RAT	Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4	261	513	4.0E-07
sp\|Q6FT96\|MDV1_CANGA	Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1	295	403	4.0E-07
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	176	255	5.0E-07
sp\|Q9D7H2\|WDR5B_MOUSE	WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1	175	292	5.0E-07
sp\|Q4V8C4\|WDR5B_RAT	WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1	175	292	5.0E-07
sp\|P29387\|GBB4_MOUSE	Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4	261	513	5.0E-07
sp\|O48847\|LUH_ARATH	Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1	307	503	5.0E-07
sp\|Q62623\|CDC20_RAT	Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2	244	513	5.0E-07
sp\|Q921C3\|BRWD1_MOUSE	Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2	185	378	5.0E-07
sp\|Q4X1Y0\|PFS2_ASPFU	Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1	181	376	5.0E-07
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	151	343	6.0E-07
sp\|P93398\|GBB2_TOBAC	Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1	171	376	6.0E-07
sp\|Q9Y297\|FBW1A_HUMAN	F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1	284	516	6.0E-07
sp\|A8NEG8\|LIS1_COPC7	Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3	342	515	7.0E-07
sp\|Q61011\|GBB3_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2	170	335	7.0E-07
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	170	378	7.0E-07
sp\|O35242\|FAN_MOUSE	Protein FAN OS=Mus musculus GN=Nsmaf PE=1 SV=2	176	380	7.0E-07
sp\|B6GZA1\|SCONB_PENRW	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1	187	404	7.0E-07
sp\|P79147\|GBB3_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1	170	335	8.0E-07
sp\|P49177\|GBB_ARATH	Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1	261	513	8.0E-07
sp\|Q3ULA2\|FBW1A_MOUSE	F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2	284	516	8.0E-07
sp\|P93563\|GBB_SOLTU	Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1	171	376	8.0E-07
sp\|Q9UTN4\|PFS2_SCHPO	Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1	171	334	9.0E-07
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	164	517	9.0E-07
sp\|Q62623\|CDC20_RAT	Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2	171	334	9.0E-07
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	171	347	1.0E-06
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	151	343	1.0E-06
sp\|Q5DFU0\|CIAO1_SCHJA	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1	298	516	1.0E-06
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	226	514	1.0E-06
sp\|P25635\|PWP2_YEAST	Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2	176	433	1.0E-06
sp\|P93398\|GBB2_TOBAC	Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1	260	380	1.0E-06
sp\|Q6NRT3\|SMU1_XENLA	WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1	263	399	1.0E-06
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	307	505	2.0E-06
sp\|Q10051\|PRP19_CAEEL	Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2	277	514	2.0E-06
sp\|D3ZW91\|POC1B_RAT	POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1	345	513	2.0E-06
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	171	375	2.0E-06
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	168	374	2.0E-06
sp\|A9V790\|LIS1_MONBE	Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1	345	514	2.0E-06
sp\|P56094\|TUP1_KLULA	General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2	352	513	2.0E-06
sp\|Q2TZG4\|PFS2_ASPOR	Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1	176	376	2.0E-06
sp\|Q08706\|GBB_LYMST	Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1	171	335	2.0E-06
sp\|Q55DA2\|CIAO1_DICDI	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1	143	379	2.0E-06
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	170	342	2.0E-06
sp\|O54927\|WSB1_MOUSE	WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1	357	517	2.0E-06
sp\|Q8VDD9\|PHIP_MOUSE	PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2	166	390	2.0E-06
sp\|Q8WWQ0\|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2	166	390	2.0E-06
sp\|P93397\|GBB1_TOBAC	Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1	260	380	2.0E-06
sp\|Q758R7\|MDV1_ASHGO	Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1	106	377	2.0E-06
sp\|O74184\|WAT1_SCHPO	WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1	179	376	2.0E-06
sp\|Q7ZVF0\|POC1A_DANRE	POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1	179	295	3.0E-06
sp\|O13615\|PRP46_SCHPO	Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1	305	516	3.0E-06
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	225	517	3.0E-06
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	291	405	3.0E-06
sp\|Q6CGP9\|PFS2_YARLI	Polyadenylation factor subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFS2 PE=3 SV=1	214	379	3.0E-06
sp\|Q8VZS9\|FZR1_ARATH	Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1	243	513	3.0E-06
sp\|C4R6H3\|LIS1_PICPG	Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1	184	377	3.0E-06
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	171	334	4.0E-06
sp\|P23232\|GBB_LOLFO	Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1	261	513	4.0E-06
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	225	514	4.0E-06
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	168	374	5.0E-06
sp\|Q20636\|GBB2_CAEEL	Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2	171	292	5.0E-06
sp\|Q9Y6I7\|WSB1_HUMAN	WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1	357	517	6.0E-06
sp\|Q229Z6\|POC1_TETTS	POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1	144	295	8.0E-06
sp\|Q8SQS4\|TAF5_ENCCU	Transcription initiation factor TFIID subunit 5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF5 PE=1 SV=1	290	503	8.0E-06
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	166	398	8.0E-06
sp\|P93563\|GBB_SOLTU	Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1	260	380	8.0E-06
sp\|Q0D0X6\|LIS1_ASPTN	Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1	260	387	9.0E-06

[Show less]

GO

GO Term	Description	Terminal node
GO:0005515	protein binding	Yes
GO:0003674	molecular_function	No
GO:0005488	binding	No

SignalP

[Help with interpreting these statistics]

SignalP signal predicted	Location (based on Ymax)	D score (significance: > 0.45)
No	1 - 50	0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequence	Sequence
Locus	Download genbank file of locus The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein	>Agabi119p4\|092460 MPDLTLDTLIDDGDYLGSERARLENKVILDELERKKKARSLAVPTDDTRVRARLREIGEPITLFGERAADRRDRL IYVLSQINAARGEDALPIESESSEEESEDEEEFYTPGSLELLEARRRIAEFSLPRAQNRVARQRLDSRMELGKIV DTRKKVFNEVKKFSNLGSQIGDERPIAQVRFSPNNEILATGSWSGTVKLWNVPACTEMRSLRGHSDKVSGVAWHP QSTLSQNPDVVNLASGGGEGNVNLWSMSSDQPLSVLKGHQDRVCRVAFHPSGDYVASASFDTTWRLWDVNTSKEL MLQEGHSKEVFTVEFQDDGALIVSGGLDAIARVWDLRTGRTAMILDGHVQAIYSIAFSPNGYQVATGAGDDTIRL WDIRSLKALYTIPAHLSNVSDIRFFRANDLFFKPVKVDEDIDMNGMDEDPNQRDSTESENKEEADITTKGFTQDE WRYRSGLFFASAGYDGLVKLWSADDWQLLRTLTTDAGKVMSVDISSDGGMVASGTYNRNFQLYTPED*
Coding	>Agabi119p4\|092460 ATGCCCGACCTCACCCTCGATACCCTCATCGACGATGGCGACTACCTCGGCTCAGAGCGTGCCAGACTCGAGAAC AAAGTCATCCTCGACGAGCTCGAGCGGAAAAAGAAAGCACGCTCCTTGGCCGTTCCAACAGACGACACTCGCGTT CGCGCCCGGCTAAGGGAAATTGGCGAGCCCATTACATTGTTCGGTGAACGTGCTGCCGATCGTCGAGACCGTCTC ATATACGTCCTCTCCCAAATAAATGCGGCACGCGGAGAAGATGCCCTGCCAATAGAATCCGAATCCTCAGAAGAA GAAAGTGAAGATGAGGAAGAATTTTATACACCTGGTTCCCTCGAACTACTCGAAGCCCGCAGGCGAATAGCAGAA TTTTCTCTGCCCAGAGCTCAAAATCGAGTCGCCCGGCAGCGATTAGATAGCAGGATGGAACTTGGAAAAATTGTT GACACGAGGAAGAAAGTATTCAACGAAGTCAAGAAATTCTCCAATTTAGGTTCTCAGATTGGCGACGAACGACCT ATTGCTCAAGTTCGGTTTTCGCCCAACAATGAAATACTGGCGACTGGTAGTTGGTCGGGGACAGTCAAACTGTGG AATGTCCCTGCTTGCACAGAAATGCGCTCCCTCAGAGGGCATAGTGACAAAGTCAGTGGTGTTGCATGGCACCCT CAATCCACATTATCTCAAAATCCAGATGTAGTCAATCTTGCTAGCGGCGGGGGTGAAGGAAATGTCAATCTCTGG TCTATGAGCAGTGATCAACCTCTTTCAGTTCTCAAAGGCCACCAGGACAGAGTATGTCGCGTGGCCTTCCATCCA TCAGGAGATTACGTTGCTAGTGCCAGCTTTGACACTACTTGGCGCCTCTGGGATGTCAACACCTCCAAAGAATTA ATGTTACAGGAGGGACACTCAAAAGAGGTTTTTACTGTCGAATTCCAGGATGATGGCGCTTTGATTGTTTCTGGT GGTCTGGACGCCATCGCGCGTGTTTGGGACTTGCGCACAGGAAGAACGGCTATGATTCTTGATGGGCACGTTCAA GCCATCTATTCTATTGCTTTTTCTCCAAACGGATACCAAGTCGCGACAGGTGCAGGTGACGACACCATACGCCTA TGGGATATACGATCTCTTAAAGCGCTCTATACTATTCCTGCTCATTTGTCTAACGTCTCTGATATCCGATTCTTC CGCGCCAACGATCTCTTTTTCAAACCTGTCAAGGTAGATGAAGATATTGATATGAATGGAATGGACGAAGACCCT AACCAACGCGATTCCACCGAATCTGAAAATAAAGAGGAAGCTGATATCACAACGAAGGGATTCACACAAGACGAA TGGCGATACCGCTCGGGTCTGTTCTTTGCCAGTGCTGGCTATGACGGACTTGTGAAGCTTTGGAGTGCGGACGAT TGGCAGCTGTTGAGAACGCTTACAACAGATGCGGGAAAGGTCATGAGTGTAGATATCTCGAGCGATGGAGGGATG GTTGCTTCTGGAACGTACAATAGAAATTTTCAATTGTATACTCCCGAAGATTAG
Transcript	>Agabi119p4\|092460 ATGCCCGACCTCACCCTCGATACCCTCATCGACGATGGCGACTACCTCGGCTCAGAGCGTGCCAGACTCGAGAAC AAAGTCATCCTCGACGAGCTCGAGCGGAAAAAGAAAGCACGCTCCTTGGCCGTTCCAACAGACGACACTCGCGTT CGCGCCCGGCTAAGGGAAATTGGCGAGCCCATTACATTGTTCGGTGAACGTGCTGCCGATCGTCGAGACCGTCTC ATATACGTCCTCTCCCAAATAAATGCGGCACGCGGAGAAGATGCCCTGCCAATAGAATCCGAATCCTCAGAAGAA GAAAGTGAAGATGAGGAAGAATTTTATACACCTGGTTCCCTCGAACTACTCGAAGCCCGCAGGCGAATAGCAGAA TTTTCTCTGCCCAGAGCTCAAAATCGAGTCGCCCGGCAGCGATTAGATAGCAGGATGGAACTTGGAAAAATTGTT GACACGAGGAAGAAAGTATTCAACGAAGTCAAGAAATTCTCCAATTTAGGTTCTCAGATTGGCGACGAACGACCT ATTGCTCAAGTTCGGTTTTCGCCCAACAATGAAATACTGGCGACTGGTAGTTGGTCGGGGACAGTCAAACTGTGG AATGTCCCTGCTTGCACAGAAATGCGCTCCCTCAGAGGGCATAGTGACAAAGTCAGTGGTGTTGCATGGCACCCT CAATCCACATTATCTCAAAATCCAGATGTAGTCAATCTTGCTAGCGGCGGGGGTGAAGGAAATGTCAATCTCTGG TCTATGAGCAGTGATCAACCTCTTTCAGTTCTCAAAGGCCACCAGGACAGAGTATGTCGCGTGGCCTTCCATCCA TCAGGAGATTACGTTGCTAGTGCCAGCTTTGACACTACTTGGCGCCTCTGGGATGTCAACACCTCCAAAGAATTA ATGTTACAGGAGGGACACTCAAAAGAGGTTTTTACTGTCGAATTCCAGGATGATGGCGCTTTGATTGTTTCTGGT GGTCTGGACGCCATCGCGCGTGTTTGGGACTTGCGCACAGGAAGAACGGCTATGATTCTTGATGGGCACGTTCAA GCCATCTATTCTATTGCTTTTTCTCCAAACGGATACCAAGTCGCGACAGGTGCAGGTGACGACACCATACGCCTA TGGGATATACGATCTCTTAAAGCGCTCTATACTATTCCTGCTCATTTGTCTAACGTCTCTGATATCCGATTCTTC CGCGCCAACGATCTCTTTTTCAAACCTGTCAAGGTAGATGAAGATATTGATATGAATGGAATGGACGAAGACCCT AACCAACGCGATTCCACCGAATCTGAAAATAAAGAGGAAGCTGATATCACAACGAAGGGATTCACACAAGACGAA TGGCGATACCGCTCGGGTCTGTTCTTTGCCAGTGCTGGCTATGACGGACTTGTGAAGCTTTGGAGTGCGGACGAT TGGCAGCTGTTGAGAACGCTTACAACAGATGCGGGAAAGGTCATGAGTGTAGATATCTCGAGCGATGGAGGGATG GTTGCTTCTGGAACGTACAATAGAAATTTTCAATTGTATACTCCCGAAGATTAG
Gene	>Agabi119p4\|092460 ATGCCCGACCTCACCCTCGATACCCTCATCGACGATGGCGACTACCTCGGCTCAGAGCGTGCCAGACTCGAGAAC AAAGTCATCCTCGACGAGCTCGAGCGGAAAAAGAAAGCACGCTCCTTGGCCGTTCCAACAGACGACACTCGCGTT CGCGCCCGGCTAAGGGAAATTGGCGAGCCCATTACATTGTTCGGTGAACGTGTGCGTATCAGGCCCACTCATCCG ACGTATCCATTCAACTTTCCTTCAGGCTGCCGATCGTCGAGACCGTCTCATATACGTCCTCTCCCAAATAAATGC GGCACGCGGAGAAGATGCCCTGCCAATAGAATCCGAATCCTCAGAAGAAGAAAGTGAAGATGTTCGTATAATCTC CACCACTTTGACTGTTTATTAATATCTTTAAAGGAGGAAGAATTTTATACACCTGGTTCCCTCGAACTACTCGAA GCCCGCAGGCGAATAGCAGAATTTTCTCTGCCCAGGTCGGCTCCTTCGCGTCTCCTCTGGACTATTGCTAACAGT ATCCTTTTCCCCCCCTTGGAACAGAGCTCAAAATCGAGTCGCCCGGCAGCGATTAGATAGCAGGATGGAACTTGG AAAAATTGTTGACACGAGGAAGAAAGTATTCAACGAAGTCAAGGTTAGTACGTTCCATGATGCCCGCAATTTCCA CTGACATGAATTACTAGAAATTCTCCAATTTAGGTTCTCAGATTGGCGACGAACGACCTATTGCTCAAGTTCGGT TTTCGCCCAACAATGAAATACTGGCGACTGGTAGTTGGTCGGGGACAGTCAAACTGTGGAATGTCCCTGCTTGCA CAGAAATGCGCTCCCTCAGAGGTGAGTCTGTCGCACGTTCCTCCCTGTAATATTCTATACGTCATGTTCTAGGGC ATAGTGACAAAGTCAGTGGTGTTGCATGGCACCCTCAATCCACATTATCTCAAAATCCAGATGTAGTCAATCTTG CTAGCGGCGGGGGTGAAGGAAATGTCAATCTCTGGTCTATGAGCAGGTAAAATCACATTTGTCAGCCTCACGCTA GATCTTTTTCTAACTCAAGTGTTCACTCAGTGATCAACCTCTTTCAGTTCTCAAAGGCCACCAGGACAGAGTATG TCGCGTGGCCTTCCATCCATCAGGAGATTACGTTGCTAGTGCCAGCTTTGACACTACTTGGCGCCTCTGGGATGT CAACACCTCCAAAGAATTAATGTTACAGGAGGGACACTCAAAAGAGGTTTTTACTGTCGAATTCCAGGATGATGG CGCTTTGATTGTTTCTGGGTTTGTTTTGGTCCCAAATTTCCTGATTCACGTTTCCTAACAAAATATCTCAGTGGT CTGGACGCCATCGCGCGTGTTTGGGACTTGCGCACAGGAAGAACGGCTATGATTCTTGATGGGCACGTTCAAGCC ATCTATTCTATTGCTTTTTCTCCAAACGGGTCTGTACACATTCCCGAGTTTTCATTCAGCTTACTCATCCTTCAT TAGATACCAAGTCGCGACAGGTGCAGGTGACGACACCATACGCCTATGGGATATACGATCTCTTAAAGCGCTCTA TACTATTCCTGCTCATTTGTCTAACGTCTCTGATATCCGATTCTTCCGCGCCAACGATCTCTTTTTCAAACCTGT CAAGGTAGATGAAGATATTGATATGAATGGAATGGACGAAGACCCTAACCAACGCGATTCCACCGAATCTGAAAA TAAAGAGGAAGCTGATATCACAACGAAGGGATTCACACAAGACGAATGGCGATACCGCTCGGGTCTGTTCTTTGC CAGTGCTGGCTATGACGGACTTGTGAAGCTTTGGAGTGCGGACGATTGGCAGCTGTTGAGAACGCTTACAACAGA TGCGGGAAAGGTCATGAGTGTAGATATCTCGAGCGATGGAGGGATGGTTGCTTCTGGAACGTACAATAGAAATTT TCAATTGTATACTCCCGAAGATTAG

Fungal Genomics

General Properties

PFAM Domains

Swissprot hits

GO

SignalP

Transmembrane Domains

Transcription Factor Class

Expression data

Sequences