Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|092420
Gene name
Locationscaffold_06:1064615..1071106
Strand-
Gene length (bp)6491
Transcript length (bp)5931
Coding sequence length (bp)5931
Protein length (aa) 1977

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.9E-70 1324 1575
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 6.8E-54 1323 1569
PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain) 8.7E-09 1664 1712
PF00307 CH Calponin homology (CH) domain 8.7E-07 523 606

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 1322 1577 6.0E-82
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 1322 1577 2.0E-81
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 1322 1577 9.0E-80
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 1322 1605 4.0E-77
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 1324 1578 5.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 1322 1577 6.0E-82
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 1322 1577 2.0E-81
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 1322 1577 9.0E-80
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 1322 1605 4.0E-77
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 1324 1578 5.0E-76
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 1321 1576 4.0E-75
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 1322 1595 3.0E-74
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 1322 1595 5.0E-73
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 1297 1578 5.0E-62
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 1322 1573 9.0E-62
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 1304 1585 3.0E-59
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 1318 1575 6.0E-58
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 1322 1576 3.0E-57
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 1322 1578 6.0E-56
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 1313 1575 2.0E-55
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 1313 1595 7.0E-55
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 1312 1575 3.0E-54
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 1317 1575 4.0E-54
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 1319 1575 2.0E-53
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 1322 1577 1.0E-52
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 1281 1574 3.0E-51
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 1325 1575 1.0E-50
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 1281 1574 2.0E-50
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 1325 1574 9.0E-50
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 1328 1576 6.0E-49
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 1318 1577 2.0E-48
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 1301 1576 5.0E-48
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 1325 1576 8.0E-47
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 1322 1577 1.0E-46
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 1260 1576 2.0E-46
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 1319 1576 2.0E-45
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 1318 1576 5.0E-45
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 1319 1575 5.0E-45
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 1319 1575 5.0E-45
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 1298 1577 7.0E-45
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 1319 1575 8.0E-45
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 1317 1577 9.0E-45
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 1316 1576 1.0E-44
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 1328 1578 4.0E-44
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 1317 1577 7.0E-44
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 1318 1577 7.0E-44
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 1317 1577 7.0E-44
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 1317 1577 9.0E-44
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 1328 1576 1.0E-43
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 1328 1575 1.0E-43
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 1328 1575 1.0E-43
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 1322 1576 2.0E-43
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 1328 1575 9.0E-43
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 1328 1575 9.0E-43
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 1328 1575 1.0E-42
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 1194 1576 2.0E-42
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 1299 1578 8.0E-42
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 1328 1578 2.0E-41
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 1311 1576 4.0E-41
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 1364 1575 4.0E-41
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 1317 1577 4.0E-41
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 1309 1575 5.0E-41
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 1316 1576 5.0E-41
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 1328 1578 6.0E-41
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 1317 1577 6.0E-41
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 1312 1575 6.0E-41
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 1317 1577 7.0E-41
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 1312 1575 7.0E-41
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 1317 1577 7.0E-41
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 1317 1577 8.0E-41
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 1318 1575 9.0E-41
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 1317 1577 1.0E-40
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 1317 1577 1.0E-40
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 1317 1577 1.0E-40
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 1322 1579 1.0E-40
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 1317 1577 2.0E-40
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 1315 1576 2.0E-40
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 1299 1578 2.0E-40
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 1318 1576 2.0E-40
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 1299 1578 2.0E-40
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 1312 1575 2.0E-40
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 1312 1575 3.0E-40
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 1312 1575 3.0E-40
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 1317 1577 3.0E-40
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 1312 1575 5.0E-40
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 1322 1578 6.0E-40
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 1306 1576 6.0E-40
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 1302 1576 7.0E-40
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 1302 1576 7.0E-40
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 1302 1576 7.0E-40
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 1302 1576 7.0E-40
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 1317 1577 8.0E-40
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 1318 1575 9.0E-40
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 1317 1576 9.0E-40
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 1317 1577 9.0E-40
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 1322 1576 9.0E-40
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 1312 1575 1.0E-39
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 1318 1600 1.0E-39
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 1302 1576 1.0E-39
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 1312 1575 1.0E-39
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 1318 1575 1.0E-39
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 1322 1576 2.0E-39
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 1317 1575 2.0E-39
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 1302 1576 2.0E-39
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 1308 1577 2.0E-39
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 1326 1576 2.0E-39
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 1312 1576 2.0E-39
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 1328 1576 3.0E-39
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 1322 1575 3.0E-39
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 1308 1578 3.0E-39
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 1318 1575 3.0E-39
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 1301 1576 4.0E-39
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 1328 1578 4.0E-39
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 1328 1578 4.0E-39
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 1301 1576 4.0E-39
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 1301 1576 4.0E-39
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 1322 1578 4.0E-39
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 1322 1575 5.0E-39
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 1311 1575 5.0E-39
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 1322 1578 6.0E-39
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 1301 1576 6.0E-39
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 1317 1577 1.0E-38
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 1302 1576 1.0E-38
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 1311 1584 1.0E-38
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 1302 1576 1.0E-38
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 1302 1576 1.0E-38
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 1322 1578 1.0E-38
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 1302 1576 1.0E-38
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 1322 1606 2.0E-38
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 1318 1577 2.0E-38
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 1325 1579 2.0E-38
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 1313 1579 3.0E-38
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 1322 1578 3.0E-38
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 1322 1578 3.0E-38
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 1322 1578 4.0E-38
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 1322 1576 4.0E-38
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 1320 1579 5.0E-38
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 1322 1578 6.0E-38
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 1328 1609 6.0E-38
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 1322 1574 6.0E-38
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 1322 1578 7.0E-38
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 1321 1565 7.0E-38
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 1328 1575 8.0E-38
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 1289 1578 8.0E-38
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 1321 1565 2.0E-37
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 1322 1578 2.0E-37
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 1306 1575 2.0E-37
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 1322 1576 2.0E-37
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 1322 1578 2.0E-37
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 1316 1578 2.0E-37
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 1317 1576 2.0E-37
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 1322 1578 3.0E-37
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 1302 1576 3.0E-37
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 1321 1565 4.0E-37
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 1308 1575 4.0E-37
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 1316 1578 4.0E-37
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 1227 1587 6.0E-37
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 1318 1576 6.0E-37
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 1322 1567 7.0E-37
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 1316 1578 8.0E-37
sp|Q02779|M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens GN=MAP3K10 PE=1 SV=3 1319 1565 8.0E-37
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 1328 1576 1.0E-36
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 1328 1572 1.0E-36
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 1322 1565 1.0E-36
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 1328 1572 2.0E-36
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 1322 1583 2.0E-36
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 1306 1587 3.0E-36
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 1302 1576 4.0E-36
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 1328 1572 4.0E-36
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 1319 1575 4.0E-36
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 1322 1565 4.0E-36
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 1318 1572 4.0E-36
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 1322 1565 5.0E-36
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 1318 1575 6.0E-36
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 1284 1578 7.0E-36
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 1241 1578 7.0E-36
sp|Q66L42|M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus GN=Map3k10 PE=1 SV=2 1319 1565 9.0E-36
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 1328 1609 9.0E-36
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 1328 1575 9.0E-36
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 1312 1587 1.0E-35
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 1318 1597 1.0E-35
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 1321 1576 1.0E-35
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 1237 1578 1.0E-35
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 1311 1576 1.0E-35
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 1316 1577 1.0E-35
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 1328 1575 1.0E-35
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 1312 1577 2.0E-35
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 1328 1575 2.0E-35
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 1328 1575 2.0E-35
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 1322 1577 2.0E-35
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 1322 1576 2.0E-35
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 1316 1575 2.0E-35
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 1328 1575 3.0E-35
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 1328 1572 4.0E-35
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 1284 1578 4.0E-35
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 1311 1575 5.0E-35
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 1285 1575 5.0E-35
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 1311 1575 5.0E-35
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 1328 1572 5.0E-35
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 1285 1575 6.0E-35
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 1318 1576 6.0E-35
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 1322 1577 6.0E-35
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 1316 1575 6.0E-35
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 1328 1576 7.0E-35
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 1328 1576 7.0E-35
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 1299 1578 7.0E-35
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 1328 1572 8.0E-35
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 1299 1578 8.0E-35
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 1306 1575 8.0E-35
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 1322 1577 8.0E-35
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 1322 1579 9.0E-35
sp|Q80XI6|M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus GN=Map3k11 PE=1 SV=1 1261 1565 9.0E-35
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 1316 1575 9.0E-35
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 1322 1602 1.0E-34
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 1322 1577 1.0E-34
sp|Q66HA1|M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus GN=Map3k11 PE=1 SV=1 1261 1565 1.0E-34
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 1322 1577 1.0E-34
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 1320 1577 1.0E-34
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 1328 1576 1.0E-34
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 1317 1600 1.0E-34
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 1318 1578 1.0E-34
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 1322 1576 1.0E-34
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 1315 1598 1.0E-34
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 1317 1600 1.0E-34
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 1316 1575 2.0E-34
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 1322 1578 2.0E-34
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 1328 1575 2.0E-34
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 1328 1576 2.0E-34
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 1306 1575 2.0E-34
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 1285 1575 3.0E-34
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 1318 1572 3.0E-34
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 1322 1602 3.0E-34
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 1322 1575 3.0E-34
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 1322 1569 3.0E-34
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 1325 1579 4.0E-34
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 1328 1576 4.0E-34
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 1328 1571 4.0E-34
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 1320 1575 4.0E-34
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 1316 1575 5.0E-34
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 1322 1600 5.0E-34
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 1322 1569 5.0E-34
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 1284 1576 5.0E-34
sp|Q16584|M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens GN=MAP3K11 PE=1 SV=1 1261 1565 6.0E-34
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 1322 1569 6.0E-34
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 1328 1576 6.0E-34
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 1316 1577 6.0E-34
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 1328 1575 7.0E-34
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 1305 1587 7.0E-34
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 1325 1579 7.0E-34
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 1323 1576 8.0E-34
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 1305 1587 8.0E-34
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 1328 1576 8.0E-34
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 1318 1576 8.0E-34
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 1321 1578 1.0E-33
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 1328 1583 1.0E-33
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 1322 1542 1.0E-33
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 1310 1575 1.0E-33
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 1328 1575 1.0E-33
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 1328 1576 2.0E-33
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 1322 1600 2.0E-33
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 1303 1587 2.0E-33
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 1322 1595 2.0E-33
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 1303 1587 2.0E-33
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 1322 1576 2.0E-33
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 1322 1575 2.0E-33
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 1325 1579 2.0E-33
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 1328 1609 3.0E-33
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 1328 1572 3.0E-33
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 1316 1576 3.0E-33
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 1322 1578 4.0E-33
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 1322 1583 4.0E-33
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 1316 1576 4.0E-33
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 1328 1578 4.0E-33
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 1318 1576 4.0E-33
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 1320 1578 4.0E-33
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 1320 1578 4.0E-33
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 1298 1575 4.0E-33
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 1322 1575 4.0E-33
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 1321 1575 5.0E-33
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 1322 1575 5.0E-33
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 1322 1578 5.0E-33
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 1322 1579 5.0E-33
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 1321 1580 6.0E-33
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 1325 1575 6.0E-33
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 1321 1575 7.0E-33
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 1328 1564 7.0E-33
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 1325 1575 7.0E-33
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 1322 1579 7.0E-33
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 1328 1572 8.0E-33
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 1322 1579 9.0E-33
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 1322 1579 9.0E-33
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 1287 1575 1.0E-32
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 1328 1581 1.0E-32
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 1321 1575 1.0E-32
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 1316 1575 1.0E-32
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 1316 1575 1.0E-32
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 1321 1565 1.0E-32
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 1322 1576 1.0E-32
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 1324 1565 1.0E-32
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 1321 1575 1.0E-32
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 1322 1580 1.0E-32
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 1322 1576 1.0E-32
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 1325 1575 2.0E-32
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 1325 1575 2.0E-32
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 1316 1575 2.0E-32
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 1322 1585 2.0E-32
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 1328 1564 2.0E-32
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 1321 1576 2.0E-32
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 1328 1577 2.0E-32
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 1321 1575 2.0E-32
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 1316 1575 2.0E-32
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 1328 1571 2.0E-32
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 1318 1578 2.0E-32
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 1316 1575 2.0E-32
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 1328 1576 2.0E-32
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 1321 1576 2.0E-32
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 1328 1575 2.0E-32
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 1328 1576 2.0E-32
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 1310 1575 3.0E-32
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 1322 1591 4.0E-32
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 1328 1564 6.0E-32
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 1328 1578 6.0E-32
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 1322 1620 6.0E-32
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 1322 1595 6.0E-32
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 1322 1621 7.0E-32
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 1328 1598 8.0E-32
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 1322 1578 9.0E-32
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 1313 1590 9.0E-32
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 1318 1601 1.0E-31
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 1328 1598 1.0E-31
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 1328 1598 1.0E-31
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 1296 1579 1.0E-31
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 1322 1595 1.0E-31
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 1328 1564 1.0E-31
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 1306 1575 2.0E-31
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 1322 1575 2.0E-31
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 1322 1579 2.0E-31
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 1328 1575 3.0E-31
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 1318 1594 3.0E-31
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 1322 1575 3.0E-31
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 1321 1576 3.0E-31
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 1328 1570 4.0E-31
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 1328 1514 4.0E-31
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 1328 1619 4.0E-31
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 1322 1583 5.0E-31
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 1322 1606 5.0E-31
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 1322 1576 5.0E-31
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 1322 1626 6.0E-31
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 1322 1578 6.0E-31
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 1322 1577 7.0E-31
sp|Q7T2V3|M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis GN=map3k10 PE=1 SV=1 1321 1572 7.0E-31
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 1322 1588 8.0E-31
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 1322 1588 8.0E-31
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 1321 1575 1.0E-30
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 1322 1579 1.0E-30
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 1322 1575 2.0E-30
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 1322 1605 2.0E-30
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 1322 1575 2.0E-30
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 1319 1576 2.0E-30
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 1322 1597 2.0E-30
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 1321 1579 2.0E-30
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 1321 1575 2.0E-30
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 1322 1587 2.0E-30
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 1308 1577 2.0E-30
sp|P08018|PBS2_YEAST MAP kinase kinase PBS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBS2 PE=1 SV=4 1299 1575 2.0E-30
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 1321 1575 2.0E-30
sp|Q8CE90|MP2K7_MOUSE Dual specificity mitogen-activated protein kinase kinase 7 OS=Mus musculus GN=Map2k7 PE=1 SV=1 1328 1585 3.0E-30
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 1328 1574 3.0E-30
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 1315 1575 3.0E-30
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 1322 1576 3.0E-30
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 1315 1576 3.0E-30
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 1315 1576 4.0E-30
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 1311 1579 4.0E-30
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 1321 1577 4.0E-30
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 1318 1564 5.0E-30
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 1322 1563 5.0E-30
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 1328 1575 5.0E-30
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 1322 1644 5.0E-30
sp|Q5TCX8|M3KL4_HUMAN Mitogen-activated protein kinase kinase kinase MLK4 OS=Homo sapiens GN=MLK4 PE=1 SV=1 1322 1572 5.0E-30
sp|Q8VDG6|M3KL4_MOUSE Mitogen-activated protein kinase kinase kinase MLK4 OS=Mus musculus GN=Mlk4 PE=1 SV=2 1322 1572 5.0E-30
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 1322 1579 6.0E-30
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 1322 1576 6.0E-30
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 1322 1574 6.0E-30
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 1328 1522 7.0E-30
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 1322 1563 7.0E-30
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 1322 1574 7.0E-30
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 1310 1575 7.0E-30
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 1326 1581 8.0E-30
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 1307 1579 9.0E-30
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 1322 1575 9.0E-30
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 1318 1576 1.0E-29
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 1322 1587 1.0E-29
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 1322 1574 1.0E-29
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 1321 1576 1.0E-29
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 1322 1542 1.0E-29
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 1322 1592 1.0E-29
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 1322 1590 1.0E-29
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 1315 1576 1.0E-29
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 1322 1576 1.0E-29
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 1307 1575 1.0E-29
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 1322 1579 1.0E-29
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 1307 1575 1.0E-29
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 1328 1577 2.0E-29
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 1328 1577 2.0E-29
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 1322 1577 2.0E-29
sp|Q4KSH7|MP2K7_RAT Dual specificity mitogen-activated protein kinase kinase 7 OS=Rattus norvegicus GN=Map2k7 PE=1 SV=1 1328 1577 2.0E-29
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 1322 1621 2.0E-29
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 1322 1578 2.0E-29
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 1320 1591 2.0E-29
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 1328 1577 2.0E-29
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 1315 1630 2.0E-29
sp|O14733|MP2K7_HUMAN Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens GN=MAP2K7 PE=1 SV=2 1328 1576 2.0E-29
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 1273 1610 2.0E-29
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 1322 1520 2.0E-29
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 1321 1592 2.0E-29
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 1325 1580 3.0E-29
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 1315 1630 3.0E-29
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 1322 1576 3.0E-29
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 1322 1575 3.0E-29
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 1328 1587 3.0E-29
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 1328 1587 4.0E-29
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 1328 1587 4.0E-29
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 1328 1569 4.0E-29
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 1321 1577 4.0E-29
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 1328 1575 4.0E-29
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 1325 1580 4.0E-29
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 1297 1576 4.0E-29
sp|Q99558|M3K14_HUMAN Mitogen-activated protein kinase kinase kinase 14 OS=Homo sapiens GN=MAP3K14 PE=1 SV=2 1328 1566 5.0E-29
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 1321 1576 5.0E-29
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 1328 1541 5.0E-29
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 1322 1610 5.0E-29
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 1321 1577 5.0E-29
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 1328 1580 5.0E-29
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 1321 1576 5.0E-29
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 1322 1576 5.0E-29
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 1322 1579 5.0E-29
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 1318 1578 6.0E-29
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 1328 1575 6.0E-29
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 1322 1579 7.0E-29
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 1321 1576 7.0E-29
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 1328 1576 7.0E-29
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 1322 1575 7.0E-29
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 1321 1576 7.0E-29
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 1328 1577 7.0E-29
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 1313 1579 7.0E-29
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 1322 1575 8.0E-29
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 1322 1579 8.0E-29
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 1328 1620 8.0E-29
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 1328 1580 9.0E-29
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 1321 1571 1.0E-28
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 1322 1582 1.0E-28
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 1322 1575 1.0E-28
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 1322 1579 1.0E-28
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 1315 1580 1.0E-28
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 1321 1576 1.0E-28
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 1322 1605 1.0E-28
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 1326 1575 1.0E-28
sp|Q13163|MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens GN=MAP2K5 PE=1 SV=2 1328 1575 1.0E-28
sp|Q62862|MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus GN=Map2k5 PE=1 SV=1 1328 1575 1.0E-28
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 1328 1575 1.0E-28
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 1321 1576 1.0E-28
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 1321 1576 1.0E-28
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 1328 1577 1.0E-28
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 1321 1576 1.0E-28
sp|Q5HZ38|GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana GN=GRIK2 PE=1 SV=1 1328 1575 1.0E-28
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 1322 1583 2.0E-28
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 1328 1580 2.0E-28
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 1325 1575 2.0E-28
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 1322 1576 2.0E-28
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 1318 1577 2.0E-28
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 1329 1582 2.0E-28
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 1322 1575 3.0E-28
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 1320 1558 3.0E-28
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 1322 1576 3.0E-28
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 1322 1583 3.0E-28
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 1294 1587 3.0E-28
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 1328 1580 3.0E-28
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 1322 1576 3.0E-28
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 1321 1577 3.0E-28
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 1321 1577 4.0E-28
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 1321 1576 4.0E-28
sp|Q9WVS7|MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus GN=Map2k5 PE=1 SV=1 1328 1575 4.0E-28
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 1328 1578 4.0E-28
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 1320 1575 4.0E-28
sp|O23304|BLUS1_ARATH Serine/threonine-protein kinase BLUS1 OS=Arabidopsis thaliana GN=BLUS1 PE=1 SV=1 1328 1577 4.0E-28
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 1322 1623 4.0E-28
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 1322 1583 5.0E-28
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 1321 1577 5.0E-28
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 1316 1588 5.0E-28
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 1312 1630 5.0E-28
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 1322 1593 6.0E-28
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 1322 1547 6.0E-28
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 1312 1579 6.0E-28
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 1321 1576 6.0E-28
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 1322 1591 6.0E-28
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 1328 1575 7.0E-28
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 1322 1589 7.0E-28
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 1322 1576 7.0E-28
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 1322 1579 7.0E-28
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 1312 1630 8.0E-28
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 1322 1576 8.0E-28
sp|Q23977|HEP_DROME Dual specificity mitogen-activated protein kinase kinase hemipterous OS=Drosophila melanogaster GN=hep PE=1 SV=2 1323 1599 8.0E-28
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 1321 1576 8.0E-28
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 1322 1575 8.0E-28
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 1321 1577 9.0E-28
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 1322 1593 7.0E-18
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 1328 1591 8.0E-17
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 1328 1591 1.0E-16
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 1322 1589 4.0E-16
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 1369 1520 4.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005524 ATP binding Yes
GO:0006468 protein phosphorylation Yes
GO:0004672 protein kinase activity Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016310 phosphorylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0008150 biological_process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0036211 protein modification process No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0043412 macromolecule modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|092420
METKREHRLGDDSNSTRHGRGAPGLALFSFALTFSGRPDLPSRRSRRPALLPWSMAIPSLPASPPLVLDGSSRTF
TRLSSLKQTIRTATRSKKSPASEADDPAATITLKGKGKEVVTVEDVPKERDRMNVFGKLGTTFRRARKESSSQLS
QGNSADHNDRAATRTTYTAPSLRGASLSSPALHLSSQALPSPKSQPSVLASSSGAAALVSPTRDRSKRVSLQPHS
PETGSPVSRRERQTRNPSTRHRATKSNPPDPAPTLKNPPRGSSRHPDSQSPRPSMDTDSLPETPSPSPPAHRGRL
VFAPPAARSESSTPRTARPISPLRARSPTHPRVLTPTTRGLTSSSTSHLPSSSPSHRRSSVDAPRRSSIDSSRRP
SVDSPRRNSGETSRLSSRGSPVDRRVESPTPVRPRPISPQQRSYAQNRHYNISSASLISPSYNAEHRERIRKAAS
MLCKEMIRPPSFISRSDQAKRDWEAVEIRMQPLARLERVWGMSSISSSNNLNSSTSGISSNGSSGVGEERERRAF
CEALRDGFVLCQLMNKLRGGNAVRPDPREDGFIKSSNVTRFLAGCASYGLGSEDLFQRDDLIEGTGESLARVAHT
IITLIQFVETPAPSRIKWIKGASQRSKGASPTSSAVPGPYMRGSIGRAASSTPNLSPQSVSPRKRYSPPAGLPPL
RSDSSEEALVSTSPLRPVHKSKDYRAGVNVLGSDSEMTTPGDLTDREGGRESVDNMEGEEVVVKSTPVAFVLKPP
PKSPLRARTIRNRQERNDQEISEWARKAAVPSSSPTASRMRYEPGSPTALRHDLGLSRTDSVVAESTRASVGSSS
FLGSPVGYGQSNESSYARQSVASTAMTDTTITTQVSSILDHSPRVGRSSDNNKFGTIRTMTTDLTSESPSIGRAE
GADIVEESTDGNGKMDLMSLLTPPTPPPKGHRERRGSNTHGHAVDLTRVAEEPDESGLLSCRGKGKEKMRQRDPK
GKTLIEESSTKGQKQREGKGGKGGGGEESEKAADRIHAVHLHKAKWPDDFLEAFQMRNPISRSPSPLNSDPLPPT
HSYPTPVSRSVSPPSKLAIVDGGRRLSDSSEVACLAPRRPTHLSRHSLDTPGSGSSSSLLPKEASQLRRDVSPDG
VRGASGSGSRLVVRRTSTNKSLLSQTRTSNNLSRYSPDVEGSESREKSPDGIRKERRGSSGIKPVPVPFPRGEHS
NTPSPSPRTESVIKATRDASNLGAAESAKSSEATAQEKRPRPPRGRFQSEINGSSRVKLRPNSYDELGARPVRSR
IESMVNLGRADAALASASDLMVRDSADGSAVRKTLVVKEEGKPPTHFQLGNCIGKGQFGSVYRALNLTTGQMVAV
KRLRLEGLKEDEISTLMREVDLLKSLSHPGIVKYEGMTRDDDTLNIILEYAENGSLAHTLKAFGKLNEKLVASYV
VKILEGLHYLHQSDVVHCDLKAANILTTKNGNVKLSDFGVSLNLRAVERQTQNDVAGTPNWMAPEVIELKGASTK
SDIWSLGCTVIELLTGRPPYGEISNSMTVMFRIVEDEMPIPPGCSELLQDFLEQCFNKNPVMRPNAELLCEHPWL
KNNWVALKDLRPQDSIPFLRRVSADLQKSDMTRYFAGLPESPTTTEFPRDVAGSPSPVPPASPVGKRTSNASIRP
APPVRDAEYHPSDHNFVKTTFSKPVVCRVCLENVKKSAVLCAECSLIAHSKCAPNAPPTCDLRSQLLLYAHYAEQ
GNPAGLYSNPLFDHPEIPCGPTAMSDIPYVAHNTPRTSFDTQHVHHSTSPIPSSPPTAFKFMAAFKRSRSSLTNE
AASTSGTQAPDADNLDSRTAVPSTSVNKSGELHFEERPQLPRKNHAVLHKRSRERPRSYTSTSTGLSSLRSATTA
AESLNSSTAETGRNVRVSGAGTTSSHDRTSSSGHKMEQARSRKTISIKTQAPSGVTSDVETNDFAELSTASSVLP
GSLSLDTNRRTRSKHESKQSGNCIVQ*
Coding >Agabi119p4|092420
ATGGAAACAAAACGGGAACATCGGCTTGGAGATGACAGCAACTCTACACGGCATGGTCGCGGTGCGCCAGGCCTC
GCTCTCTTCTCCTTTGCACTGACTTTCTCCGGCCGGCCTGATCTTCCGTCCCGCCGATCCCGCCGCCCTGCCCTC
CTCCCTTGGTCCATGGCTATCCCTTCATTACCGGCATCCCCCCCACTCGTCCTCGACGGTTCATCCCGCACATTC
ACCCGTCTCTCTTCACTTAAGCAGACCATCCGCACTGCAACTCGCTCCAAGAAGTCCCCCGCTTCAGAGGCGGAT
GACCCCGCCGCAACTATTACTTTAAAAGGGAAAGGCAAGGAAGTCGTTACGGTCGAAGATGTGCCGAAAGAGAGG
GACCGCATGAACGTGTTTGGCAAGCTTGGGACTACCTTTCGCCGCGCTCGCAAAGAGTCATCCTCCCAGTTATCT
CAAGGAAACTCTGCGGATCATAATGACAGAGCTGCTACCAGGACCACTTATACTGCTCCGTCCCTCAGGGGCGCG
TCTTTATCTTCACCAGCGCTTCACCTCTCATCACAGGCCCTTCCGTCACCAAAGTCACAACCCTCAGTTCTGGCC
TCCTCTTCTGGTGCCGCTGCTCTAGTATCTCCTACGCGAGATCGCTCAAAGCGAGTGAGCCTGCAGCCCCATTCT
CCAGAAACAGGTAGTCCTGTGTCGAGAAGAGAACGACAAACTCGCAACCCTTCCACCCGTCATCGTGCAACGAAA
TCGAATCCTCCAGATCCAGCTCCCACTCTCAAAAACCCTCCTCGAGGATCTTCTCGTCACCCCGACTCCCAGAGC
CCCCGCCCTTCGATGGACACGGACTCTCTTCCCGAGACTCCCTCACCATCTCCACCTGCACATCGTGGGAGACTC
GTCTTCGCTCCACCTGCCGCCCGTTCGGAATCTTCCACTCCCAGAACTGCCCGTCCCATTAGCCCGCTCAGAGCA
CGATCTCCCACGCATCCTCGCGTCCTTACTCCGACAACCAGGGGCCTGACGTCCAGTTCTACGTCACATCTACCT
TCCAGTTCACCGTCACATAGGCGGTCATCTGTCGATGCTCCTCGGCGGTCTTCCATTGACTCTTCTCGTCGGCCT
TCAGTCGATTCTCCGCGCCGAAATTCCGGAGAAACATCCCGCTTGTCTTCGCGAGGTTCGCCTGTGGATCGTCGT
GTTGAATCTCCAACGCCTGTTCGTCCTCGTCCTATATCGCCCCAACAAAGATCCTATGCTCAGAATCGTCACTAT
AATATCTCATCAGCATCATTAATATCACCGTCGTATAATGCTGAGCATCGTGAACGGATACGGAAGGCGGCGTCG
ATGCTTTGCAAGGAAATGATTCGTCCACCGTCATTTATAAGTAGATCGGACCAAGCGAAGCGGGACTGGGAGGCC
GTTGAGATACGAATGCAGCCACTGGCGAGATTGGAGCGAGTCTGGGGTATGAGTAGTATTAGCTCCTCCAATAAC
CTTAATTCGTCTACCTCTGGCATAAGCTCCAACGGATCGAGTGGTGTGGGAGAAGAGAGGGAAAGACGGGCTTTC
TGCGAAGCTTTAAGGGATGGCTTTGTGCTATGCCAGCTCATGAACAAACTTCGTGGGGGTAATGCTGTTCGACCT
GACCCTCGTGAGGATGGCTTTATTAAATCGTCCAACGTTACTCGGTTCCTTGCAGGGTGTGCTTCCTATGGGCTC
GGCAGCGAAGACTTATTTCAACGTGATGATTTGATCGAGGGTACAGGCGAATCGCTTGCCCGGGTCGCGCATACA
ATCATAACCCTCATTCAATTCGTCGAAACGCCTGCTCCCTCGCGTATCAAGTGGATCAAAGGCGCTTCACAACGA
TCCAAAGGCGCATCACCGACCTCTTCAGCCGTGCCTGGACCATATATGAGAGGCTCAATCGGTAGAGCGGCATCA
TCGACACCTAATCTGTCACCTCAGTCTGTTTCCCCTAGAAAAAGATATAGTCCGCCTGCTGGTTTACCACCCTTG
CGATCCGATAGTTCTGAGGAAGCCCTTGTATCAACTTCGCCATTGCGCCCGGTGCATAAATCGAAGGATTACCGG
GCTGGTGTGAACGTTCTTGGATCAGACTCGGAAATGACGACCCCGGGGGATTTGACGGATAGGGAAGGTGGTCGG
GAATCTGTAGATAACATGGAGGGGGAGGAAGTTGTAGTCAAATCCACGCCAGTAGCATTTGTGCTCAAACCACCA
CCAAAATCACCATTACGTGCTCGGACTATAAGAAATCGCCAGGAACGTAATGATCAAGAAATTTCGGAATGGGCT
AGGAAAGCTGCCGTTCCTTCCAGTTCCCCTACAGCTTCAAGGATGCGTTACGAACCTGGATCACCCACTGCTCTT
CGACATGATCTCGGATTGTCTCGTACAGACTCTGTAGTGGCAGAATCGACGAGAGCGTCGGTTGGAAGCTCGTCA
TTTTTGGGGTCTCCGGTCGGATATGGTCAGTCGAACGAGAGCAGTTATGCTCGGCAATCTGTTGCGTCGACCGCG
ATGACGGATACGACTATCACTACTCAAGTGTCAAGCATCCTCGATCACTCTCCTCGTGTGGGGCGGAGCAGCGAT
AATAACAAGTTTGGAACGATTAGGACGATGACGACTGATTTGACTTCTGAAAGTCCTTCGATTGGAAGAGCCGAA
GGTGCTGATATCGTGGAGGAATCAACCGATGGTAATGGGAAGATGGATTTAATGTCATTGTTAACACCGCCTACA
CCTCCACCAAAGGGACACCGAGAGAGGAGGGGGAGTAATACCCATGGACATGCAGTTGATTTGACGAGGGTAGCG
GAGGAGCCAGATGAGAGTGGGTTGTTGTCATGCAGGGGAAAGGGGAAAGAAAAGATGAGACAAAGGGACCCGAAG
GGCAAAACACTCATCGAAGAGTCATCGACCAAAGGGCAAAAACAACGTGAAGGTAAAGGAGGTAAAGGGGGAGGG
GGTGAAGAAAGCGAGAAAGCGGCTGATAGGATCCATGCAGTACACCTTCATAAAGCCAAATGGCCGGATGACTTC
TTAGAAGCATTTCAAATGCGAAATCCAATTAGTCGATCACCGTCGCCCCTCAACAGTGATCCTTTACCTCCCACT
CATTCATATCCTACCCCTGTCTCTCGGTCGGTTTCCCCTCCGAGTAAGCTTGCAATAGTGGACGGAGGAAGACGT
CTCAGTGACTCTAGTGAAGTTGCTTGCTTGGCTCCCAGGAGACCGACGCATTTATCCCGGCACAGTTTGGATACA
CCAGGGTCTGGCTCATCGTCTTCTTTACTACCAAAAGAGGCATCTCAATTACGGAGGGATGTCAGCCCAGATGGG
GTCCGTGGGGCATCCGGGTCTGGAAGTAGGCTCGTGGTCCGAAGGACGAGTACAAACAAGAGTCTGCTGAGTCAA
ACGCGAACAAGCAATAATTTGTCCAGATACTCACCGGATGTGGAAGGGAGTGAGAGTCGAGAGAAGTCACCAGAC
GGGATTAGGAAAGAGAGGAGGGGAAGTAGTGGCATCAAACCTGTACCGGTGCCATTTCCGCGTGGAGAACATTCA
AATACGCCATCGCCATCGCCGAGGACAGAAAGTGTTATCAAAGCGACTAGAGATGCTTCCAACTTGGGCGCCGCG
GAATCTGCGAAGTCATCGGAAGCTACTGCACAAGAGAAGCGACCTCGCCCACCAAGAGGACGTTTCCAGAGTGAA
ATCAATGGTAGTTCCAGGGTGAAGCTGAGACCGAATTCGTATGACGAGCTTGGTGCGAGGCCGGTGAGATCCAGG
ATTGAGAGTATGGTGAATTTGGGAAGGGCAGATGCTGCTTTGGCGAGTGCAAGTGATTTGATGGTGAGGGATTCG
GCCGATGGGAGTGCTGTGAGGAAGACGCTTGTTGTTAAGGAGGAGGGAAAGCCGCCGACTCATTTTCAACTGGGC
AACTGTATCGGTAAAGGCCAGTTTGGGAGCGTGTATAGAGCACTCAACCTCACCACTGGTCAAATGGTTGCGGTG
AAGAGGCTACGGTTGGAGGGTTTGAAGGAGGACGAAATTTCGACATTGATGAGAGAAGTTGATCTATTAAAGAGC
TTGTCGCATCCTGGAATCGTCAAATATGAGGGTATGACGCGTGATGATGATACACTCAATATCATTCTGGAGTAT
GCCGAAAATGGATCGCTTGCACATACCCTCAAAGCTTTCGGCAAACTCAATGAGAAGTTGGTAGCGAGCTATGTC
GTTAAAATTCTTGAAGGACTGCATTATCTCCATCAAAGCGATGTTGTCCATTGTGACCTGAAAGCCGCTAATATC
CTTACAACGAAGAATGGAAATGTCAAACTATCAGACTTTGGCGTTTCACTCAATCTACGAGCAGTGGAACGACAG
ACTCAGAACGATGTAGCGGGAACTCCGAACTGGATGGCCCCGGAGGTGATCGAGCTCAAGGGCGCTTCGACTAAG
TCGGATATCTGGTCATTGGGTTGTACGGTTATCGAGCTACTGACCGGGAGACCCCCTTATGGGGAGATATCCAAT
AGTATGACCGTCATGTTCCGAATAGTCGAGGACGAAATGCCTATTCCCCCAGGGTGTTCCGAGCTGCTGCAAGAC
TTCCTGGAACAGTGTTTCAATAAAAATCCCGTAATGCGGCCGAATGCTGAACTTCTCTGCGAACATCCTTGGTTA
AAGAATAACTGGGTTGCCCTCAAGGACCTTCGGCCACAAGACAGTATACCGTTCCTTCGCCGTGTTAGTGCAGAT
TTACAGAAATCAGATATGACACGATATTTTGCCGGCCTGCCTGAATCGCCAACGACCACAGAGTTCCCGAGAGAC
GTTGCCGGAAGCCCATCTCCTGTTCCACCTGCCTCTCCCGTTGGGAAGCGGACTTCAAATGCTTCGATTCGACCC
GCACCACCTGTTCGTGATGCTGAATACCATCCGAGCGACCATAACTTCGTCAAGACAACCTTCAGTAAACCTGTG
GTTTGTAGAGTCTGCCTTGAGAATGTGAAGAAGAGTGCTGTACTTTGTGCCGAGTGCAGCTTGATCGCACATTCT
AAATGCGCACCAAATGCGCCGCCAACCTGTGACCTCCGTTCACAATTACTCTTATATGCCCACTACGCGGAACAG
GGGAACCCTGCCGGTTTATATTCTAACCCGTTATTCGATCATCCCGAGATTCCGTGTGGGCCCACAGCGATGTCG
GATATACCCTATGTCGCGCATAATACCCCACGTACCAGTTTTGATACCCAGCACGTACATCATTCCACGAGTCCC
ATTCCAAGCTCCCCTCCGACAGCTTTCAAATTCATGGCAGCTTTCAAACGTTCTAGGTCTAGCCTAACAAATGAA
GCGGCTTCGACTTCGGGTACCCAAGCTCCCGACGCAGACAATCTCGATTCAAGAACGGCTGTCCCTTCTACTTCC
GTCAATAAATCCGGTGAACTGCACTTCGAAGAGAGACCACAGTTACCTCGCAAGAATCATGCAGTCTTGCACAAA
CGGTCTAGAGAACGTCCCAGGTCGTACACCAGCACTAGTACCGGTCTCAGTAGCTTGCGCAGTGCTACCACAGCC
GCTGAAAGCCTGAATAGTAGCACGGCAGAGACGGGACGCAACGTCCGAGTATCCGGTGCAGGAACGACGTCATCG
CATGATAGGACCTCCAGCAGTGGCCATAAAATGGAGCAAGCGAGAAGCAGGAAAACTATCTCCATCAAAACTCAA
GCACCTTCGGGAGTGACATCCGATGTGGAGACGAATGATTTTGCGGAGCTTAGTACGGCTTCGTCTGTACTTCCT
GGATCGTTATCTTTAGATACGAATCGTAGGACAAGATCCAAACATGAATCAAAACAATCGGGGAATTGTATCGTG
CAATAG
Transcript >Agabi119p4|092420
ATGGAAACAAAACGGGAACATCGGCTTGGAGATGACAGCAACTCTACACGGCATGGTCGCGGTGCGCCAGGCCTC
GCTCTCTTCTCCTTTGCACTGACTTTCTCCGGCCGGCCTGATCTTCCGTCCCGCCGATCCCGCCGCCCTGCCCTC
CTCCCTTGGTCCATGGCTATCCCTTCATTACCGGCATCCCCCCCACTCGTCCTCGACGGTTCATCCCGCACATTC
ACCCGTCTCTCTTCACTTAAGCAGACCATCCGCACTGCAACTCGCTCCAAGAAGTCCCCCGCTTCAGAGGCGGAT
GACCCCGCCGCAACTATTACTTTAAAAGGGAAAGGCAAGGAAGTCGTTACGGTCGAAGATGTGCCGAAAGAGAGG
GACCGCATGAACGTGTTTGGCAAGCTTGGGACTACCTTTCGCCGCGCTCGCAAAGAGTCATCCTCCCAGTTATCT
CAAGGAAACTCTGCGGATCATAATGACAGAGCTGCTACCAGGACCACTTATACTGCTCCGTCCCTCAGGGGCGCG
TCTTTATCTTCACCAGCGCTTCACCTCTCATCACAGGCCCTTCCGTCACCAAAGTCACAACCCTCAGTTCTGGCC
TCCTCTTCTGGTGCCGCTGCTCTAGTATCTCCTACGCGAGATCGCTCAAAGCGAGTGAGCCTGCAGCCCCATTCT
CCAGAAACAGGTAGTCCTGTGTCGAGAAGAGAACGACAAACTCGCAACCCTTCCACCCGTCATCGTGCAACGAAA
TCGAATCCTCCAGATCCAGCTCCCACTCTCAAAAACCCTCCTCGAGGATCTTCTCGTCACCCCGACTCCCAGAGC
CCCCGCCCTTCGATGGACACGGACTCTCTTCCCGAGACTCCCTCACCATCTCCACCTGCACATCGTGGGAGACTC
GTCTTCGCTCCACCTGCCGCCCGTTCGGAATCTTCCACTCCCAGAACTGCCCGTCCCATTAGCCCGCTCAGAGCA
CGATCTCCCACGCATCCTCGCGTCCTTACTCCGACAACCAGGGGCCTGACGTCCAGTTCTACGTCACATCTACCT
TCCAGTTCACCGTCACATAGGCGGTCATCTGTCGATGCTCCTCGGCGGTCTTCCATTGACTCTTCTCGTCGGCCT
TCAGTCGATTCTCCGCGCCGAAATTCCGGAGAAACATCCCGCTTGTCTTCGCGAGGTTCGCCTGTGGATCGTCGT
GTTGAATCTCCAACGCCTGTTCGTCCTCGTCCTATATCGCCCCAACAAAGATCCTATGCTCAGAATCGTCACTAT
AATATCTCATCAGCATCATTAATATCACCGTCGTATAATGCTGAGCATCGTGAACGGATACGGAAGGCGGCGTCG
ATGCTTTGCAAGGAAATGATTCGTCCACCGTCATTTATAAGTAGATCGGACCAAGCGAAGCGGGACTGGGAGGCC
GTTGAGATACGAATGCAGCCACTGGCGAGATTGGAGCGAGTCTGGGGTATGAGTAGTATTAGCTCCTCCAATAAC
CTTAATTCGTCTACCTCTGGCATAAGCTCCAACGGATCGAGTGGTGTGGGAGAAGAGAGGGAAAGACGGGCTTTC
TGCGAAGCTTTAAGGGATGGCTTTGTGCTATGCCAGCTCATGAACAAACTTCGTGGGGGTAATGCTGTTCGACCT
GACCCTCGTGAGGATGGCTTTATTAAATCGTCCAACGTTACTCGGTTCCTTGCAGGGTGTGCTTCCTATGGGCTC
GGCAGCGAAGACTTATTTCAACGTGATGATTTGATCGAGGGTACAGGCGAATCGCTTGCCCGGGTCGCGCATACA
ATCATAACCCTCATTCAATTCGTCGAAACGCCTGCTCCCTCGCGTATCAAGTGGATCAAAGGCGCTTCACAACGA
TCCAAAGGCGCATCACCGACCTCTTCAGCCGTGCCTGGACCATATATGAGAGGCTCAATCGGTAGAGCGGCATCA
TCGACACCTAATCTGTCACCTCAGTCTGTTTCCCCTAGAAAAAGATATAGTCCGCCTGCTGGTTTACCACCCTTG
CGATCCGATAGTTCTGAGGAAGCCCTTGTATCAACTTCGCCATTGCGCCCGGTGCATAAATCGAAGGATTACCGG
GCTGGTGTGAACGTTCTTGGATCAGACTCGGAAATGACGACCCCGGGGGATTTGACGGATAGGGAAGGTGGTCGG
GAATCTGTAGATAACATGGAGGGGGAGGAAGTTGTAGTCAAATCCACGCCAGTAGCATTTGTGCTCAAACCACCA
CCAAAATCACCATTACGTGCTCGGACTATAAGAAATCGCCAGGAACGTAATGATCAAGAAATTTCGGAATGGGCT
AGGAAAGCTGCCGTTCCTTCCAGTTCCCCTACAGCTTCAAGGATGCGTTACGAACCTGGATCACCCACTGCTCTT
CGACATGATCTCGGATTGTCTCGTACAGACTCTGTAGTGGCAGAATCGACGAGAGCGTCGGTTGGAAGCTCGTCA
TTTTTGGGGTCTCCGGTCGGATATGGTCAGTCGAACGAGAGCAGTTATGCTCGGCAATCTGTTGCGTCGACCGCG
ATGACGGATACGACTATCACTACTCAAGTGTCAAGCATCCTCGATCACTCTCCTCGTGTGGGGCGGAGCAGCGAT
AATAACAAGTTTGGAACGATTAGGACGATGACGACTGATTTGACTTCTGAAAGTCCTTCGATTGGAAGAGCCGAA
GGTGCTGATATCGTGGAGGAATCAACCGATGGTAATGGGAAGATGGATTTAATGTCATTGTTAACACCGCCTACA
CCTCCACCAAAGGGACACCGAGAGAGGAGGGGGAGTAATACCCATGGACATGCAGTTGATTTGACGAGGGTAGCG
GAGGAGCCAGATGAGAGTGGGTTGTTGTCATGCAGGGGAAAGGGGAAAGAAAAGATGAGACAAAGGGACCCGAAG
GGCAAAACACTCATCGAAGAGTCATCGACCAAAGGGCAAAAACAACGTGAAGGTAAAGGAGGTAAAGGGGGAGGG
GGTGAAGAAAGCGAGAAAGCGGCTGATAGGATCCATGCAGTACACCTTCATAAAGCCAAATGGCCGGATGACTTC
TTAGAAGCATTTCAAATGCGAAATCCAATTAGTCGATCACCGTCGCCCCTCAACAGTGATCCTTTACCTCCCACT
CATTCATATCCTACCCCTGTCTCTCGGTCGGTTTCCCCTCCGAGTAAGCTTGCAATAGTGGACGGAGGAAGACGT
CTCAGTGACTCTAGTGAAGTTGCTTGCTTGGCTCCCAGGAGACCGACGCATTTATCCCGGCACAGTTTGGATACA
CCAGGGTCTGGCTCATCGTCTTCTTTACTACCAAAAGAGGCATCTCAATTACGGAGGGATGTCAGCCCAGATGGG
GTCCGTGGGGCATCCGGGTCTGGAAGTAGGCTCGTGGTCCGAAGGACGAGTACAAACAAGAGTCTGCTGAGTCAA
ACGCGAACAAGCAATAATTTGTCCAGATACTCACCGGATGTGGAAGGGAGTGAGAGTCGAGAGAAGTCACCAGAC
GGGATTAGGAAAGAGAGGAGGGGAAGTAGTGGCATCAAACCTGTACCGGTGCCATTTCCGCGTGGAGAACATTCA
AATACGCCATCGCCATCGCCGAGGACAGAAAGTGTTATCAAAGCGACTAGAGATGCTTCCAACTTGGGCGCCGCG
GAATCTGCGAAGTCATCGGAAGCTACTGCACAAGAGAAGCGACCTCGCCCACCAAGAGGACGTTTCCAGAGTGAA
ATCAATGGTAGTTCCAGGGTGAAGCTGAGACCGAATTCGTATGACGAGCTTGGTGCGAGGCCGGTGAGATCCAGG
ATTGAGAGTATGGTGAATTTGGGAAGGGCAGATGCTGCTTTGGCGAGTGCAAGTGATTTGATGGTGAGGGATTCG
GCCGATGGGAGTGCTGTGAGGAAGACGCTTGTTGTTAAGGAGGAGGGAAAGCCGCCGACTCATTTTCAACTGGGC
AACTGTATCGGTAAAGGCCAGTTTGGGAGCGTGTATAGAGCACTCAACCTCACCACTGGTCAAATGGTTGCGGTG
AAGAGGCTACGGTTGGAGGGTTTGAAGGAGGACGAAATTTCGACATTGATGAGAGAAGTTGATCTATTAAAGAGC
TTGTCGCATCCTGGAATCGTCAAATATGAGGGTATGACGCGTGATGATGATACACTCAATATCATTCTGGAGTAT
GCCGAAAATGGATCGCTTGCACATACCCTCAAAGCTTTCGGCAAACTCAATGAGAAGTTGGTAGCGAGCTATGTC
GTTAAAATTCTTGAAGGACTGCATTATCTCCATCAAAGCGATGTTGTCCATTGTGACCTGAAAGCCGCTAATATC
CTTACAACGAAGAATGGAAATGTCAAACTATCAGACTTTGGCGTTTCACTCAATCTACGAGCAGTGGAACGACAG
ACTCAGAACGATGTAGCGGGAACTCCGAACTGGATGGCCCCGGAGGTGATCGAGCTCAAGGGCGCTTCGACTAAG
TCGGATATCTGGTCATTGGGTTGTACGGTTATCGAGCTACTGACCGGGAGACCCCCTTATGGGGAGATATCCAAT
AGTATGACCGTCATGTTCCGAATAGTCGAGGACGAAATGCCTATTCCCCCAGGGTGTTCCGAGCTGCTGCAAGAC
TTCCTGGAACAGTGTTTCAATAAAAATCCCGTAATGCGGCCGAATGCTGAACTTCTCTGCGAACATCCTTGGTTA
AAGAATAACTGGGTTGCCCTCAAGGACCTTCGGCCACAAGACAGTATACCGTTCCTTCGCCGTGTTAGTGCAGAT
TTACAGAAATCAGATATGACACGATATTTTGCCGGCCTGCCTGAATCGCCAACGACCACAGAGTTCCCGAGAGAC
GTTGCCGGAAGCCCATCTCCTGTTCCACCTGCCTCTCCCGTTGGGAAGCGGACTTCAAATGCTTCGATTCGACCC
GCACCACCTGTTCGTGATGCTGAATACCATCCGAGCGACCATAACTTCGTCAAGACAACCTTCAGTAAACCTGTG
GTTTGTAGAGTCTGCCTTGAGAATGTGAAGAAGAGTGCTGTACTTTGTGCCGAGTGCAGCTTGATCGCACATTCT
AAATGCGCACCAAATGCGCCGCCAACCTGTGACCTCCGTTCACAATTACTCTTATATGCCCACTACGCGGAACAG
GGGAACCCTGCCGGTTTATATTCTAACCCGTTATTCGATCATCCCGAGATTCCGTGTGGGCCCACAGCGATGTCG
GATATACCCTATGTCGCGCATAATACCCCACGTACCAGTTTTGATACCCAGCACGTACATCATTCCACGAGTCCC
ATTCCAAGCTCCCCTCCGACAGCTTTCAAATTCATGGCAGCTTTCAAACGTTCTAGGTCTAGCCTAACAAATGAA
GCGGCTTCGACTTCGGGTACCCAAGCTCCCGACGCAGACAATCTCGATTCAAGAACGGCTGTCCCTTCTACTTCC
GTCAATAAATCCGGTGAACTGCACTTCGAAGAGAGACCACAGTTACCTCGCAAGAATCATGCAGTCTTGCACAAA
CGGTCTAGAGAACGTCCCAGGTCGTACACCAGCACTAGTACCGGTCTCAGTAGCTTGCGCAGTGCTACCACAGCC
GCTGAAAGCCTGAATAGTAGCACGGCAGAGACGGGACGCAACGTCCGAGTATCCGGTGCAGGAACGACGTCATCG
CATGATAGGACCTCCAGCAGTGGCCATAAAATGGAGCAAGCGAGAAGCAGGAAAACTATCTCCATCAAAACTCAA
GCACCTTCGGGAGTGACATCCGATGTGGAGACGAATGATTTTGCGGAGCTTAGTACGGCTTCGTCTGTACTTCCT
GGATCGTTATCTTTAGATACGAATCGTAGGACAAGATCCAAACATGAATCAAAACAATCGGGGAATTGTATCGTG
CAATAG
Gene >Agabi119p4|092420
ATGGAAACAAAACGGGAACATCGGCTTGGAGATGACAGCAACTCTACACGGCATGGTCGCGGTGCGCCAGGCCTC
GCTCTCTTCTCCTTTGCACTGACTTTCTCCGGCCGGGTAGGTTTGAATCATTTTCAATACCATCCACTCATCTTC
TTCCTTAGCCTGATCTTCCGTCCCGCCGATCCCGCCGCCCTGCCCTCCTCCCTTGGTCCATGGCTGTAGCCCTTC
AAACAACAAAATCTTTTCTGTCGTAATCATGCCTCCCCACCAACGCACCACTCCTCAGATCCCTTCATTACCGGC
ATCCCCCCCACTCGTCCTCGACGGTTCATCCCGCACATTCACCCGTCTCTCTTCACTTAAGCAGACCATCCGCAC
TGCAACTCGCTCCAAGAAGTCCCCCGCTTCAGAGGCGGATGACCCCGCCGCAACTATTACTTTAAAAGGGAAAGG
CAAGGAAGTCGTTACGGTCGAAGATGTGCCGAAAGAGAGGGACCGCATGAACGTGTTTGGCAAGCTTGGGACTAC
CTTTCGCCGCGCTCGCAAAGAGTCATCCTCCCAGTTATCTCAAGGAAACTCTGCGGATCATAATGACAGAGCTGC
TACCAGGACCACTTATACTGCTCCGTCCCTCAGGGGCGCGTCTTTATCTTCACCAGCGCTTCACCTCTCATCACA
GGCCCTTCCGTCACCAAAGTCACAACCCTCAGTTCTGGCCTCCTCTTCTGGTGCCGCTGCTCTAGTATCTCCTAC
GCGAGATCGCTCAAAGCGAGTGAGCCTGCAGCCCCATTCTCCAGAAACAGGTAGTCCTGTGTCGAGAAGAGAACG
ACAAACTCGCAACCCTTCCACCCGTCATCGTGCAACGAAATCGAATCCTCCAGATCCAGCTCCCACTCTCAAAAA
CCCTCCTCGAGGATCTTCTCGTCACCCCGACTCCCAGAGCCCCCGCCCTTCGATGGACACGGACTCTCTTCCCGA
GACTCCCTCACCATCTCCACCTGCACATCGTGGGAGACTCGTCTTCGCTCCACCTGCCGCCCGTTCGGAATCTTC
CACTCCCAGAACTGCCCGTCCCATTAGCCCGCTCAGAGCACGATCTCCCACGCATCCTCGCGTCCTTACTCCGAC
AACCAGGGGCCTGACGTCCAGTTCTACGTCACATCTACCTTCCAGTTCACCGTCACATAGGCGGTCATCTGTCGA
TGCTCCTCGGCGGTCTTCCATTGACTCTTCTCGTCGGCCTTCAGTCGATTCTCCGCGCCGAAATTCCGGAGAAAC
ATCCCGCTTGTCTTCGCGAGGTTCGCCTGTGGATCGTCGTGTTGAATCTCCAACGCCTGTTCGTCCTCGTCCTAT
ATCGCCCCAACAAAGATCCTATGCTCAGAATCGTCACTATAATATCTCATCAGCATCATTAATATCACCGTCGTA
TAATGCTGAGCATCGTGAACGGATACGGAAGGCGGCGTCGATGCTTTGCAAGGAAATGATTCGTCCACCGTCATT
TATAAGTAGATCGGACCAAGCGAAGCGGGACTGGGAGGCCGTTGAGATACGAATGCAGCCACTGGCGAGATTGGA
GCGAGTCTGGGGTATGAGTAGTATTAGCTCCTCCAATAACCTTAATTCGTCTACCTCTGGCATAAGCTCCAACGG
ATCGAGTGGTGTGGGAGAAGAGAGGGAAAGACGGGCTTTCTGCGAAGCTTTAAGGGATGGCTTTGTGCTATGCCA
GTGAGTGATAGATATATTTTTCTCCTTTCTCCCTCTGCGCGGCTGCGCTGCCCAAGCTTACCATATTTTGACCAT
GTTCTCCTTTGCAGGCTCATGAACAAACTTCGTGGGGGTAATGCTGTTCGACCTGACCCTCGTGAGGATGGCTTT
ATTAAATCGTCCAACGTTACTCGGTTCCTTGCAGGGTGTGCTTCCTATGGGCTCGGCAGCGAAGACTTATTTCAA
CGTGATGATTTGATCGAGGGTACAGGCGAATCGCTTGCCCGGGTCGCGCATACAATCATAACCCTCATTCAATTC
GTCGAAACGCCTGCTCCCTCGCGTATCAAGTGGATCAAAGGCGCTTCACAACGATCCAAAGGCGCATCACCGACC
TCTTCAGCCGTGCCTGGACCATATATGAGAGGCTCAATCGGTAGAGCGGCATCATCGACACCTAATCTGTCACCT
CAGTCTGTTTCCCCTAGAAAAAGATATAGTCCGCCTGCTGGTTTACCACCCTTGCGATCCGATAGTTCTGAGGAA
GCCCTTGTATCAACTTCGCCATTGCGCCCGGTGCATAAATCGAAGGATTACCGGGCTGGTGTGAACGTTCTTGGA
TCAGACTCGGAAATGACGACCCCGGGGGATTTGACGGATAGGGAAGGTGGTCGGGAATCTGTAGATAACATGGAG
GGGGAGGAAGTTGTAGTCAAATCCACGCCAGTAGCATTTGTGCTCAAACCACCACCAAAATCACCATTACGTGCT
CGGACTATAAGAAATCGCCAGGAACGTAATGATCAAGAAATTTCGGAATGGGCTAGGAAAGCTGCCGTTCCTTCC
AGTTCCCCTACAGCTTCAAGGATGCGTTACGAACCTGGATCACCCACTGCTCTTCGACATGATCTCGGATTGTCT
CGTACAGACTCTGTAGTGGCAGAATCGACGAGAGCGTCGGTTGGAAGCTCGTCATTTTTGGGGTCTCCGGTCGGA
TATGGTCAGTCGAACGAGAGCAGTTATGCTCGGCAATCTGTTGCGTCGACCGCGATGACGGATACGACTATCACT
ACTCAAGTGTCAAGCATCCTCGATCACTCTCCTCGTGTGGGGCGGAGCAGCGATAATAACAAGTTTGGAACGATT
AGGACGATGACGACTGATTTGACTTCTGAAAGTCCTTCGATTGGAAGAGCCGAAGGTGCTGATATCGTGGAGGAA
TCAACCGATGGTAATGGGAAGATGGATTTAATGTCATTGTTAACACCGCCTACACCTCCACCAAAGGGACACCGA
GAGAGGAGGGGGAGTAATACCCATGGACATGCAGTTGATTTGACGAGGGTAGCGGAGGAGCCAGATGAGAGTGGG
TTGTTGTCATGCAGGGGAAAGGGGAAAGAAAAGATGAGACAAAGGGACCCGAAGGGCAAAACACTCATCGAAGAG
TCATCGACCAAAGGGCAAAAACAACGTGAAGGTAAAGGAGGTAAAGGGGGAGGGGGTGAAGAAAGCGAGAAAGCG
GCTGATAGGATCCATGCAGTACACCTTCATAAAGCCAAATGGCCGGATGACTTCTTAGAAGCATTTCAAATGCGA
AATCCAATTAGTCGATCACCGTCGCCCCTCAACAGTGATCCTTTACCTCCCACTCATTCATATCCTACCCCTGTC
TCTCGGTCGGTTTCCCCTCCGAGTAAGCTTGCAATAGTGGACGGAGGAAGACGTCTCAGTGACTCTAGTGAAGTT
GCTTGCTTGGCTCCCAGGAGACCGACGCATTTATCCCGGCACAGTTTGGATACACCAGGGTCTGGCTCATCGTCT
TCTTTACTACCAAAAGAGGCATCTCAATTACGGAGGGATGTCAGCCCAGATGGGGTCCGTGGGGCATCCGGGTCT
GGAAGTAGGCTCGTGGTCCGAAGGACGAGTACAAACAAGAGTCTGCTGAGTCAAACGCGAACAAGCAATAATTTG
TCCAGATACTCACCGGATGTGGAAGGGAGTGAGAGTCGAGAGAAGTCACCAGACGGGATTAGGAAAGAGAGGAGG
GGAAGTAGTGGCATCAAACCTGTACCGGTGCCATTTCCGCGTGGAGAACATTCAAATACGCCATCGCCATCGCCG
AGGACAGAAAGTGTTATCAAAGCGACTAGAGATGCTTCCAACTTGGGCGCCGCGGAATCTGCGAAGTCATCGGAA
GCTACTGCACAAGAGAAGCGACCTCGCCCACCAAGAGGACGTTTCCAGAGTGAAATCAATGGTAGTTCCAGGGTG
AAGCTGAGACCGAATTCGTATGACGAGCTTGGTGCGAGGCCGGTGAGATCCAGGATTGAGAGTATGGTGAATTTG
GGAAGGGCAGATGCTGCTTTGGCGAGTGCAAGTGATTTGATGGTGAGGGATTCGGCCGATGGGAGTGCTGTGAGG
AAGACGCTTGTTGTTAAGGAGGAGGGAAAGCCGCCGACTCATTTTGTAAGTGATTCTTCGTTGTTTTTGTATTCA
TACTGCCTCTTCAAACCCCCTCTCCCTCCAAAGAGCCCCTGTCTTTCCTTACCCGATTTGTTATCGCGGATCATG
TATTTGATTGGTCACTAACTTCTACTTCAGCAACTGGGCAACTGTATCGGTAAAGGCCAGTTTGGGAGCGTGTAT
AGAGCACTCAACCTCACCACTGGTCAAATGGTTGCGGTGAAGAGGCTACGGTTGGAGGGTTTGAAGGAGGACGAA
ATTTCGACATTGATGAGAGAAGTTGATCTATTAAAGAGCTTGTCGCATCCTGGAATCGTCAAATATGAGGGTATG
ACGCGTGATGATGATACACTCAATATCATTCTGGAGTACGACTTTATTTTCTCTAATTTCATTCTCATCTTGATG
TTTTTCGAATTTTCTAGGTATGCCGAAAATGGATCGCTTGCACATACCCTCAAAGCTTTCGGCAAACTCAATGAG
AAGTTGGTAGCGAGCTATGTCGTTAAAATTCTTGAAGGACTGCATTATCTCCATCAAAGCGATGTTGTCCATTGT
GACCTGAAAGCCGCTAATATCCTTACAACGAAGAATGGAAATGTCAAACTATCAGACTTTGGCGTTTCACTCAAT
CTACGAGCAGTGGAACGACAGACTCAGAACGATGTAGCGGGAACTCCGAACTGGATGGCCCCGGAGGTGATCGAG
CTCAAGGGCGCTTCGACTAAGTCGGATATCTGGTCATTGGGTTGTACGGTTATCGAGCTACTGACCGGGAGACCC
CCTTATGGGGAGATATCCAATAGTATGACCGGTTCGTTCATTTTTACTTTCCATTCTTACTGCGGCGCGCTTATT
CTGTTGCATTGTCAGTCATGTTCCGAATAGTCGAGGACGAAATGCCTATTCCCCCAGGGTGTTCCGAGCTGCTGC
AAGACTTCCTGGAACAGTGTTTCAATAAAAATCCCGTAATGCGGCCGAATGCTGAACTTCTCTGCGAACATCCTT
GGTTAAAGAATAACTGGGTTGCCCTCAAGGTGAGATATGGCTTTACGTGTGCCAAATACACGGTGGACTAACCCG
ATATAGGACCTTCGGCCACAAGACAGTATACCGTTCCTTCGCCGTGTTAGTGCAGATTTACAGAAATCAGATATG
ACACGATATTTTGCCGGCCTGCCTGAATCGCCAACGACCACAGAGTTCCCGAGAGACGTTGCCGGAAGCCCATCT
CCTGTTCCACCTGCCTCTCCCGTTGGGAAGCGGACTTCAAATGCTTCGATTCGACCCGCACCACCTGTTCGTGAT
GCTGAATACCATCCGAGCGACCATAACTTCGTCAAGACAACCTTCAGTAAACGTAAGTCATCCCGCGTTCCTCTC
ATCATAATATTCGCTCAACCATGTTTCTAGCTGTGGTTTGTAGAGTCTGCCTTGAGAATGTGAAGAAGAGTGCTG
TACTTTGTGCCGAGTGCAGCTTGATCGCACATTCTAAATGCGCACCAAATGCGCCGCCAACCTGTGACCTCCGTT
CACAATTACTCTTATATGCCCACTACGCGGAACAGGGGAACCCTGCCGGTTTATATTCTAACCCGTTATTCGATC
ATCCCGAGATTCCGTGTGGGCCCACAGCGATGTCGGATATACCCTATGTCGCGCATAATACCCCACGTACCAGTT
TTGATACCCAGCACGTACATCATTCCACGAGTCCCATTCCAAGCTCCCCTCCGACAGCTTTCAAATTCATGGCAG
CTTTCAAACGTTCTAGGTCTAGCCTAACAAATGAAGCGGCTTCGACTTCGGGTACCCAAGCTCCCGACGCAGACA
ATCTCGATTCAAGAACGGCTGTCCCTTCTACTTCCGTCAATAAATCCGGTGAACTGCACTTCGAAGAGAGACCAC
AGTTACCTCGCAAGAATCATGCAGTCTTGCACAAACGGTCTAGAGAACGTCCCAGGTCGTACACCAGCACTAGTA
CCGGTCTCAGTAGCTTGCGCAGTGCTACCACAGCCGCTGAAAGCCTGAATAGTAGCACGGCAGAGACGGGACGCA
ACGTCCGAGTATCCGGTGCAGGAACGACGTCATCGCATGATAGGACCTCCAGCAGTGGCCATAAAATGGAGCAAG
CGAGAAGCAGGAAAACTATCTCCATCAAAACTCAAGCACCTTCGGGAGTGACATCCGATGTGGAGACGAATGATT
TTGCGGAGCTTAGTACGGCTTCGTCTGTACTTCCTGGATCGTTATCTTTAGATACGAATCGTAGGACAAGATCCA
AACATGAATCAAAACAATCGGGGAATTGTATCGTGCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail