Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|092170
Gene name
Locationscaffold_06:1023733..1024921
Strand-
Gene length (bp)1188
Transcript length (bp)858
Coding sequence length (bp)858
Protein length (aa) 286

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 1.5E-24 99 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 24 285 7.0E-33
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 19 249 2.0E-32
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 73 248 2.0E-27
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 24 246 2.0E-25
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 15 263 3.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 24 285 7.0E-33
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 19 249 2.0E-32
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 73 248 2.0E-27
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 24 246 2.0E-25
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 15 263 3.0E-24
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 70 273 6.0E-24
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 107 246 2.0E-23
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 66 245 3.0E-23
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 44 245 1.0E-21
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 60 245 3.0E-21
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 60 245 3.0E-21
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 19 248 2.0E-20
sp|O43688|PLPP2_HUMAN Phospholipid phosphatase 2 OS=Homo sapiens GN=PLPP2 PE=1 SV=1 44 241 2.0E-19
sp|Q2HJ61|PLPP2_BOVIN Phospholipid phosphatase 2 OS=Bos taurus GN=PLPP2 PE=2 SV=1 44 238 2.0E-19
sp|Q9DAX2|PLPP2_MOUSE Phospholipid phosphatase 2 OS=Mus musculus GN=Plpp2 PE=1 SV=1 44 238 3.0E-19
sp|Q8K593|PLPP2_RAT Phospholipid phosphatase 2 OS=Rattus norvegicus GN=Plpp2 PE=2 SV=1 44 241 4.0E-19
sp|O08564|PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus GN=Plpp1 PE=1 SV=1 44 275 1.0E-17
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 21 251 4.0E-16
sp|O88956|PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus GN=PLPP1 PE=2 SV=1 44 238 8.0E-16
sp|Q3SZE3|PLPP3_BOVIN Phospholipid phosphatase 3 OS=Bos taurus GN=PLPP3 PE=2 SV=1 44 246 6.0E-15
sp|Q61469|PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus GN=Plpp1 PE=1 SV=1 44 232 6.0E-15
sp|O14495|PLPP3_HUMAN Phospholipid phosphatase 3 OS=Homo sapiens GN=PLPP3 PE=1 SV=1 44 246 4.0E-14
sp|Q9V576|WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster GN=wun PE=1 SV=2 104 238 7.0E-14
sp|O14494|PLPP1_HUMAN Phospholipid phosphatase 1 OS=Homo sapiens GN=PLPP1 PE=1 SV=1 87 238 7.0E-13
sp|P97544|PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus GN=Plpp3 PE=1 SV=1 44 246 1.0E-12
sp|Q99JY8|PLPP3_MOUSE Phospholipid phosphatase 3 OS=Mus musculus GN=Plpp3 PE=1 SV=1 44 246 2.0E-12
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 21 248 1.0E-09
sp|Q10022|YSX3_CAEEL Uncharacterized protein T28D9.3 OS=Caenorhabditis elegans GN=T28D9.3 PE=1 SV=1 116 264 6.0E-09
sp|A4II83|LPPR1_XENTR Lipid phosphate phosphatase-related protein type 1 OS=Xenopus tropicalis GN=lppr1 PE=2 SV=1 120 233 1.0E-07
sp|Q8TBJ4|LPPR1_HUMAN Lipid phosphate phosphatase-related protein type 1 OS=Homo sapiens GN=LPPR1 PE=2 SV=1 120 233 4.0E-07
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 94 240 1.0E-06
sp|Q6WAY2|LPPR1_RAT Lipid phosphate phosphatase-related protein type 1 OS=Rattus norvegicus GN=Lppr1 PE=2 SV=1 120 233 1.0E-06
sp|Q8BFZ2|LPPR1_MOUSE Lipid phosphate phosphatase-related protein type 1 OS=Mus musculus GN=Lppr1 PE=1 SV=1 120 233 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 63 85 22
3 160 179 19
4 194 213 19
5 225 244 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|092170
MITFAKRYFGQDSLSWFHKSYILDWVFVSLLWLISYFISYWPVYEREFSLTDKTIAHSHKENQVGSGFNFTAALF
VPLLLVIVVGFKNRSIVELHHGTLALLAGRGLARMITEYFKHRVGRLRPDFLARCKWDEVAELCAGKKSSILDGR
MSFPSGHSSTAFAGMIFLTLWIAGQTAAICLSAGPSVRWMPSRLAALALTLAPISWATHVAFTRIEDHRHHMEDV
IVGSLIGTFSAAICYLLFWPSPFHISSFNSSGRTEARYLYISTAQSRGTYELTTTNDDVV*
Coding >Agabi119p4|092170
ATGATCACTTTTGCAAAGCGATACTTCGGTCAAGATTCCTTGAGTTGGTTCCATAAGTCCTACATTTTGGATTGG
GTTTTCGTTAGCTTACTCTGGCTGATTTCATACTTCATATCTTATTGGCCAGTATACGAGCGAGAATTTTCGCTG
ACGGACAAGACGATTGCTCATTCTCATAAAGAAAACCAAGTTGGCTCAGGTTTCAACTTCACTGCTGCCCTCTTT
GTTCCGCTCCTACTCGTAATCGTTGTCGGTTTCAAGAACAGATCCATTGTTGAATTACATCATGGCACTCTTGCA
CTTCTGGCTGGTCGAGGTCTGGCCCGTATGATAACGGAATATTTCAAGCATAGAGTTGGGAGACTTCGTCCTGAC
TTCCTCGCAAGGTGCAAATGGGACGAAGTCGCTGAGCTCTGCGCTGGAAAGAAATCGTCTATCCTGGATGGTCGA
ATGTCATTTCCGTCCGGTCACTCATCTACGGCTTTTGCGGGCATGATTTTCCTGACACTCTGGATCGCGGGTCAG
ACCGCCGCCATATGTCTTTCTGCTGGTCCATCCGTCAGATGGATGCCAAGCCGGTTGGCAGCTCTTGCTTTGACA
CTTGCCCCCATTTCATGGGCGACCCATGTTGCCTTTACGCGAATCGAGGACCATAGACATCATATGGAAGATGTC
ATTGTAGGGAGCTTGATTGGAACTTTCTCTGCTGCCATATGTTATCTCTTGTTCTGGCCGAGCCCGTTTCATATC
AGCTCGTTCAACTCCTCGGGCAGGACTGAAGCAAGGTATCTTTATATTAGCACAGCCCAGTCGAGGGGCACTTAT
GAATTAACGACGACGAATGACGATGTAGTTTAA
Transcript >Agabi119p4|092170
ATGATCACTTTTGCAAAGCGATACTTCGGTCAAGATTCCTTGAGTTGGTTCCATAAGTCCTACATTTTGGATTGG
GTTTTCGTTAGCTTACTCTGGCTGATTTCATACTTCATATCTTATTGGCCAGTATACGAGCGAGAATTTTCGCTG
ACGGACAAGACGATTGCTCATTCTCATAAAGAAAACCAAGTTGGCTCAGGTTTCAACTTCACTGCTGCCCTCTTT
GTTCCGCTCCTACTCGTAATCGTTGTCGGTTTCAAGAACAGATCCATTGTTGAATTACATCATGGCACTCTTGCA
CTTCTGGCTGGTCGAGGTCTGGCCCGTATGATAACGGAATATTTCAAGCATAGAGTTGGGAGACTTCGTCCTGAC
TTCCTCGCAAGGTGCAAATGGGACGAAGTCGCTGAGCTCTGCGCTGGAAAGAAATCGTCTATCCTGGATGGTCGA
ATGTCATTTCCGTCCGGTCACTCATCTACGGCTTTTGCGGGCATGATTTTCCTGACACTCTGGATCGCGGGTCAG
ACCGCCGCCATATGTCTTTCTGCTGGTCCATCCGTCAGATGGATGCCAAGCCGGTTGGCAGCTCTTGCTTTGACA
CTTGCCCCCATTTCATGGGCGACCCATGTTGCCTTTACGCGAATCGAGGACCATAGACATCATATGGAAGATGTC
ATTGTAGGGAGCTTGATTGGAACTTTCTCTGCTGCCATATGTTATCTCTTGTTCTGGCCGAGCCCGTTTCATATC
AGCTCGTTCAACTCCTCGGGCAGGACTGAAGCAAGGTATCTTTATATTAGCACAGCCCAGTCGAGGGGCACTTAT
GAATTAACGACGACGAATGACGATGTAGTTTAA
Gene >Agabi119p4|092170
ATGATCACTTTTGCAAAGCGATACTTCGGTCAAGATTCCTTGAGTTGGTTCCATAAGTCCTACATTTTGGATTGG
TACGTCATTATTCCTGCAATTGTTGTATCAGCCGCTAATTTCAAAAGTAACAGGGTTTTCGTTAGCTTACTCTGG
CTGATTTCATACTTCATATCTTATTGGCCAGTATACGAGCGAGAATTTTCGCTGACGGACAAGACGATTGCTCAT
TCTCATAAAGAAAACCAGTAAGGTTTCAATTATGCATATGAAGTGCTTGACAACGATTCTTTACGCCATCTTAGA
GTTGGCTCAGGTTTCAACTTCACTGCTGCCCTCTTTGTTCCGCTCCTACTCGTAATCGTTGTCGGTTTCAAGAAC
AGATCCATTGTTGAATTACATCATGGCACTCTTGCACTTCTGGCTGGTCGGTTCGTACCAGCTGAACCCGGTCCC
TGCCAACTACTTCCTTATTCACTGTCATTCACAGAGGTCTGGCCCGTATGATAACGGAATATTTCAAGCATAGAG
TTGGTACGCGCGCCTCAATTGAAGCGTATTGCCTTCCTTTGACATTTCTTAGGGAGACTTCGTCCTGACTTCCTC
GCAAGGTGCAAATGGGACGAAGTCGCTGAGCTCTGCGCTGGGTCAGTATATCGACCATAAAATCCTCATTCAGCT
GATTTGTCCAATTCAACAGAAAGAAATCGTCTATCCTGGATGGTCGAATGTCATTTCCGTCCGGTCACTCATCTA
CGGCTTTTGCGGGCATGATTTTCCTGACACTCTGGATCGCGGGTCAGACCGCCGCCATATGTCTTTCTGCTGGTC
CATCCGTCAGATGGATGCCAAGCCGGTTGGCAGCTCTTGCTTTGACACTTGCCCCCATTTCATGGGCGACCCATG
TTGCCTTTACGCGAATCGAGGACCATGTGGGTGCTATCCTATACTTTTGCGCTATGTTATAATTTATTATTCTTG
ATTACCTAGAGACATCATATGGAAGATGTCATTGTAGGGAGCTTGATTGGAACTTTCTCTGCTGCCATATGTTAT
CTCTTGTTCTGGCCGAGCCCGTTTCATATCAGCTCGTTCAACTCCTCGGGCAGGACTGAAGCAAGGTATCTTTAT
ATTAGCACAGCCCAGTCGAGGGGCACTTATGAATTAACGACGACGAATGACGATGTAGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail