Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|091950
Gene name
Locationscaffold_06:974234..975530
Strand+
Gene length (bp)1296
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01256 Carb_kinase Carbohydrate kinase 1.5E-39 30 211
PF01256 Carb_kinase Carbohydrate kinase 4.1E-08 237 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8N8Z0|NNRD_COPC7 ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_00865 PE=3 SV=2 1 330 2.0E-174
sp|Q4P219|NNRD_USTMA ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_05844 PE=3 SV=1 5 333 6.0E-91
sp|Q5K8L4|NNRD_CRYNJ ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNL05250 PE=3 SV=1 6 338 4.0E-90
sp|E3L9T1|NNRD2_PUCGT ATP-dependent (S)-NAD(P)H-hydrate dehydratase 2 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_19074 PE=3 SV=2 5 329 3.0E-87
sp|E3LAQ9|NNRD1_PUCGT ATP-dependent (S)-NAD(P)H-hydrate dehydratase 1 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_19583 PE=3 SV=2 5 325 4.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8N8Z0|NNRD_COPC7 ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_00865 PE=3 SV=2 1 330 2.0E-174
sp|Q4P219|NNRD_USTMA ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_05844 PE=3 SV=1 5 333 6.0E-91
sp|Q5K8L4|NNRD_CRYNJ ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNL05250 PE=3 SV=1 6 338 4.0E-90
sp|E3L9T1|NNRD2_PUCGT ATP-dependent (S)-NAD(P)H-hydrate dehydratase 2 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_19074 PE=3 SV=2 5 329 3.0E-87
sp|E3LAQ9|NNRD1_PUCGT ATP-dependent (S)-NAD(P)H-hydrate dehydratase 1 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_19583 PE=3 SV=2 5 325 4.0E-86
sp|Q7SHU9|NNRD_NEUCR ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU02513 PE=3 SV=1 5 333 9.0E-85
sp|C7YKN8|NNRD_NECH7 ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_98759 PE=3 SV=1 5 334 5.0E-84
sp|O94347|NNRD_SCHPO ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC61.03 PE=3 SV=1 2 331 2.0E-79
sp|Q0UVK8|NNRD_PHANO ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_04206 PE=3 SV=1 5 334 2.0E-79
sp|F1Q575|NNRD_DANRE ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Danio rerio GN=zgc:171429 PE=3 SV=1 6 329 5.0E-79
sp|Q8IW45|NNRD_HUMAN ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Homo sapiens GN=CARKD PE=1 SV=1 6 329 1.0E-78
sp|Q5R824|NNRD_PONAB ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Pongo abelii GN=CARKD PE=2 SV=1 6 329 3.0E-78
sp|E1BNQ4|NNRD_BOVIN ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Bos taurus GN=CARKD PE=3 SV=1 7 329 4.0E-76
sp|Q9CZ42|NNRD_MOUSE ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Mus musculus GN=Carkd PE=1 SV=1 5 329 1.0E-75
sp|D4AAT7|NNRD_RAT ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Rattus norvegicus GN=Carkd PE=3 SV=1 6 329 1.0E-75
sp|E2QUI9|NNRD_CANLF ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Canis lupus familiaris GN=CARKD PE=3 SV=1 8 329 2.0E-75
sp|A7RRZ8|NNRD_NEMVE ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Nematostella vectensis GN=v1g162096 PE=3 SV=1 6 330 4.0E-74
sp|Q4X1F8|NNRD_ASPFU ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G10120 PE=3 SV=1 7 333 6.0E-72
sp|Q5B0D6|NNRD_EMENI ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5994 PE=3 SV=1 1 333 1.0E-71
sp|F4NZ38|NNRD_BATDJ ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_10166 PE=3 SV=1 9 331 4.0E-71
sp|F6RCC2|NNRD_CIOIN ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Ciona intestinalis GN=Cin.36927 PE=3 SV=1 7 331 3.0E-69
sp|B7PBI5|NNRD_IXOSC ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Ixodes scapularis GN=ISCW003308 PE=3 SV=1 13 329 4.0E-69
sp|B5DHB2|NNRD_DROPS ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Drosophila pseudoobscura pseudoobscura GN=GA25285 PE=3 SV=1 7 333 6.0E-68
sp|E3XDZ8|NNRD_ANODA ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Anopheles darlingi GN=AND_21715 PE=3 SV=1 7 329 2.0E-67
sp|C4LZV8|NNRD_ENTHI ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Entamoeba histolytica GN=EHI_194450 PE=3 SV=1 10 330 4.0E-67
sp|Q54FJ9|NNRD_DICDI ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Dictyostelium discoideum GN=DDB_G0290799 PE=3 SV=1 6 329 4.0E-67
sp|Q17NP0|NNRD_AEDAE ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Aedes aegypti GN=AAEL000673 PE=3 SV=1 7 329 2.0E-66
sp|F6HDM2|NNRD_VITVI ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Vitis vinifera GN=VIT_05s0020g02800 PE=3 SV=1 11 327 2.0E-65
sp|Q94AF2|NNRD_ARATH ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Arabidopsis thaliana GN=At5g19150 PE=2 SV=1 11 327 2.0E-64
sp|E0VSF4|NNRD_PEDHC ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Pediculus humanus subsp. corporis GN=PHUM417680 PE=3 SV=1 10 331 6.0E-63
sp|A9RY03|NNRD_PHYPA ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_121160 PE=3 SV=1 5 323 4.0E-61
sp|P36059|NNRD_YEAST ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL151C PE=1 SV=1 12 330 7.0E-60
sp|Q59M69|NNRD_CANAL ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.11002 PE=3 SV=1 5 331 1.0E-59
sp|C4YSU5|NNRD_CANAW ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Candida albicans (strain WO-1) GN=CAWG_05164 PE=3 SV=1 5 331 2.0E-59
sp|D3BMU4|NNRD_POLPA ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Polysphondylium pallidum GN=PPL_12517 PE=3 SV=1 8 329 3.0E-59
sp|C5Y210|NNRD_SORBI ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Sorghum bicolor GN=Sb05g010020 PE=3 SV=1 11 327 7.0E-59
sp|Q9VVW8|NNRD_DROME ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Drosophila melanogaster GN=CG10424 PE=2 SV=1 3 331 6.0E-57
sp|B7FXE8|NNRD_PHATC ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_19831 PE=3 SV=1 11 327 1.0E-56
sp|F7E727|NNRD_MACMU ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Macaca mulatta GN=CARKD PE=3 SV=1 6 268 1.0E-55
sp|P32740|NNRD_CAEEL ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Caenorhabditis elegans GN=R107.2 PE=3 SV=3 8 321 3.0E-54
sp|C0NFV9|NNRD_AJECG ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_01775 PE=3 SV=1 5 333 1.0E-52
sp|A8X354|NNRD_CAEBR ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Caenorhabditis briggsae GN=CBG06820 PE=3 SV=1 8 321 3.0E-50
sp|A9A498|NNRD_NITMS ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Nitrosopumilus maritimus (strain SCM1) GN=nnrD PE=3 SV=1 11 321 8.0E-20
sp|Q8ZV04|NNR_PYRAE Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=nnr PE=3 SV=1 24 264 1.0E-19
sp|P31806|NNR_ECOLI Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Escherichia coli (strain K12) GN=nnr PE=1 SV=2 3 269 6.0E-15
sp|A2BLC0|NNR_HYPBU Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=nnr PE=3 SV=1 17 325 2.0E-14
sp|A0RU82|NNRD_CENSY ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Cenarchaeum symbiosum (strain A) GN=nnrD PE=3 SV=2 9 274 4.0E-14
sp|O27324|NNR_METTH Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=nnr PE=3 SV=1 15 321 8.0E-14
sp|Q8TX67|NNR_METKA Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=nnr PE=3 SV=1 23 317 2.0E-11
sp|B1L3W1|NNR_KORCO Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Korarchaeum cryptofilum (strain OPF8) GN=nnr PE=3 SV=1 23 272 3.0E-11
sp|Q9KMX5|NNR_VIBCH Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nnr PE=3 SV=1 12 321 3.0E-10
sp|Q9X024|NNR_THEMA Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=nnr PE=1 SV=1 3 269 8.0E-10
sp|P96051|NNRD_STRTR ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Streptococcus thermophilus GN=nnrD PE=3 SV=1 16 265 2.0E-09
sp|Q58981|NNR_METJA Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=nnr PE=3 SV=1 23 321 3.0E-09
sp|A1S0R2|NNR_THEPD Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Thermofilum pendens (strain Hrk 5) GN=nnr PE=3 SV=1 15 272 5.0E-09
sp|Q4QFL5|NNR_LEIMA Bifunctional NAD(P)H-hydrate repair enzyme OS=Leishmania major GN=LMJF_14_1190 PE=3 SV=1 23 146 2.0E-08
sp|A4HW65|NNR_LEIIN Bifunctional NAD(P)H-hydrate repair enzyme OS=Leishmania infantum GN=LINJ_14_1270 PE=3 SV=1 23 146 6.0E-08
sp|B5YIM0|NNR_THEYD Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=nnr PE=3 SV=1 13 333 7.0E-08
sp|B8E2P6|NNR_DICTD Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=nnr PE=3 SV=1 32 274 7.0E-08
sp|Q83CM5|NNR_COXBU Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=nnr PE=3 SV=1 14 274 1.0E-07
sp|Q2G2P8|NNRD_STAA8 ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Staphylococcus aureus (strain NCTC 8325) GN=nnrD PE=3 SV=2 8 264 1.0E-07
sp|Q8DQD2|NNRD_STRR6 ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=nnrD PE=3 SV=1 23 264 2.0E-07
sp|Q833Y3|NNRD_ENTFA ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=nnrD PE=1 SV=1 23 265 2.0E-07
sp|Q2FT57|NNR_METHJ Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=nnr PE=3 SV=1 19 321 6.0E-07
sp|D1BAA5|NNR_THEAS Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Thermanaerovibrio acidaminovorans (strain ATCC 49978 / DSM 6589 / Su883) GN=nnr PE=3 SV=1 9 265 6.0E-07
sp|Q5F8G9|NNRD_NEIG1 ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nnrD PE=3 SV=1 23 274 8.0E-07
sp|A4H7T9|NNR_LEIBR Bifunctional NAD(P)H-hydrate repair enzyme OS=Leishmania braziliensis GN=LBRM_14_1360 PE=3 SV=1 23 150 9.0E-07
sp|F9UN92|NNRD_LACPL ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=nnrD PE=3 SV=1 23 265 1.0E-06
sp|Q2S580|NNR_SALRD Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Salinibacter ruber (strain DSM 13855 / M31) GN=nnr PE=3 SV=1 11 331 2.0E-06
sp|Q9JRZ9|NNRD_NEIMB ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Neisseria meningitidis serogroup B (strain MC58) GN=nnrD1 PE=3 SV=1 23 274 2.0E-06
sp|Q7NIE6|NNR_GLOVI Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Gloeobacter violaceus (strain PCC 7421) GN=nnr PE=3 SV=1 21 212 2.0E-06
sp|O29407|NNR_ARCFU Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=nnr PE=3 SV=1 23 321 3.0E-06
sp|Q9CIU7|NNRD_LACLA ADP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=nnrD PE=3 SV=1 9 265 5.0E-06
sp|P9WF11|NNR_MYCTU Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nnr PE=1 SV=1 24 272 7.0E-06
sp|P9WF10|NNR_MYCTO Bifunctional NAD(P)H-hydrate repair enzyme Nnr OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nnr PE=3 SV=1 24 272 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0052855 ADP-dependent NAD(P)H-hydrate dehydratase activity Yes
GO:0016835 carbon-oxygen lyase activity No
GO:0016836 hydro-lyase activity No
GO:0003824 catalytic activity No
GO:0016829 lyase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|091950
MPIPRHILEQLKALIPPLNGTLHKGQSGRVGVLGGALDYTGAPYFAAISALRMGADLSHVICSPTAAGPIKTYSP
DLIVHPILRQDAPVETVKSELDSLFSRLHVLVIGPGLGREDYMQKFARTAVSIARNRGMFLVLDADALFLVGKDI
SIIQGYRRAILTPNLVEFKRLADQVGVSPDTPVDQRARLLSKLLGGVTVLQKGAHDMIVTDTRGPDADLAASQLS
GADPEKEEFCELVKVDVPGGYKRCGGQGDILSGTVGTFLAWGLSYEEGAFGDKSIPASRVPLLAAVGGSMVTRTA
SRLAFKKAGRSLVTQDMLSEIGYAFAETFGDVEQFDGKL*
Coding >Agabi119p4|091950
ATGCCAATCCCGCGACATATCCTTGAGCAGCTAAAAGCACTCATTCCACCACTCAATGGTACTCTTCACAAAGGC
CAATCTGGAAGGGTCGGCGTGCTAGGAGGTGCGCTAGACTATACTGGCGCGCCCTACTTTGCTGCGATATCTGCC
CTTCGGATGGGAGCCGATCTTTCCCATGTAATTTGCTCGCCTACAGCTGCTGGACCTATCAAGACATATTCCCCA
GACCTGATAGTTCATCCAATCCTCCGCCAAGACGCGCCCGTCGAGACAGTAAAATCCGAACTAGATTCTCTCTTC
TCCAGACTCCACGTTCTCGTCATCGGACCAGGTCTCGGAAGAGAAGATTACATGCAAAAATTCGCACGTACAGCT
GTCAGCATTGCTCGTAACCGTGGAATGTTTCTCGTCCTCGACGCCGACGCACTTTTCTTGGTTGGAAAAGACATA
TCCATAATTCAGGGATATCGTCGTGCTATTCTTACACCCAATCTCGTTGAATTCAAACGTCTTGCTGATCAAGTT
GGCGTTAGTCCGGATACTCCAGTCGATCAAAGGGCTCGATTGTTGTCCAAGTTACTTGGAGGTGTTACGGTACTC
CAGAAAGGAGCTCACGACATGATTGTTACCGATACTCGAGGACCGGATGCCGATCTCGCAGCGAGTCAATTGTCT
GGGGCAGACCCCGAGAAGGAAGAATTCTGTGAGCTTGTCAAAGTCGATGTGCCTGGTGGATATAAGAGATGTGGT
GGACAAGGCGATATTCTAAGCGGTACCGTCGGTACATTCCTTGCATGGGGTTTAAGCTATGAAGAAGGGGCATTT
GGAGATAAAAGCATTCCGGCATCTCGAGTACCTCTCCTTGCCGCCGTTGGTGGAAGTATGGTTACCCGTACGGCC
AGTCGTCTGGCTTTCAAGAAGGCAGGAAGAAGTTTGGTAACTCAGGATATGCTTTCCGAGATCGGTTACGCGTTT
GCAGAAACATTTGGTGATGTCGAACAATTTGACGGAAAACTCTAG
Transcript >Agabi119p4|091950
ATGCCAATCCCGCGACATATCCTTGAGCAGCTAAAAGCACTCATTCCACCACTCAATGGTACTCTTCACAAAGGC
CAATCTGGAAGGGTCGGCGTGCTAGGAGGTGCGCTAGACTATACTGGCGCGCCCTACTTTGCTGCGATATCTGCC
CTTCGGATGGGAGCCGATCTTTCCCATGTAATTTGCTCGCCTACAGCTGCTGGACCTATCAAGACATATTCCCCA
GACCTGATAGTTCATCCAATCCTCCGCCAAGACGCGCCCGTCGAGACAGTAAAATCCGAACTAGATTCTCTCTTC
TCCAGACTCCACGTTCTCGTCATCGGACCAGGTCTCGGAAGAGAAGATTACATGCAAAAATTCGCACGTACAGCT
GTCAGCATTGCTCGTAACCGTGGAATGTTTCTCGTCCTCGACGCCGACGCACTTTTCTTGGTTGGAAAAGACATA
TCCATAATTCAGGGATATCGTCGTGCTATTCTTACACCCAATCTCGTTGAATTCAAACGTCTTGCTGATCAAGTT
GGCGTTAGTCCGGATACTCCAGTCGATCAAAGGGCTCGATTGTTGTCCAAGTTACTTGGAGGTGTTACGGTACTC
CAGAAAGGAGCTCACGACATGATTGTTACCGATACTCGAGGACCGGATGCCGATCTCGCAGCGAGTCAATTGTCT
GGGGCAGACCCCGAGAAGGAAGAATTCTGTGAGCTTGTCAAAGTCGATGTGCCTGGTGGATATAAGAGATGTGGT
GGACAAGGCGATATTCTAAGCGGTACCGTCGGTACATTCCTTGCATGGGGTTTAAGCTATGAAGAAGGGGCATTT
GGAGATAAAAGCATTCCGGCATCTCGAGTACCTCTCCTTGCCGCCGTTGGTGGAAGTATGGTTACCCGTACGGCC
AGTCGTCTGGCTTTCAAGAAGGCAGGAAGAAGTTTGGTAACTCAGGATATGCTTTCCGAGATCGGTTACGCGTTT
GCAGAAACATTTGGTGATGTCGAACAATTTGACGGAAAACTCTAG
Gene >Agabi119p4|091950
ATGCCAATCCCGCGACATATCCTTGAGCAGCTAAAAGCACTCATTCCACCACTCAATGGTACTCTTCACAAAGGC
CAATCTGGTCAGTCCTATCTACACTAACCAATATCATCTGCATTGACTTGAAAAAACATCTCCCAGGAAGGGTCG
GCGTGCTAGGAGGTGCGCTAGAGTGCGTTGAGCTCTCAAAATATACTTGCTGCTTTGTGTATTAAGATATCTAAA
GCTATACTGGCGCGCCCTACTTTGCTGCGATATCTGCCCTTCGGATGGTACGCAAAAGCAATCACAATGCGTGGC
TCAATCACTGGACGCTTTCCTAGGGAGCCGATCTTTCCCATGTAATTTGCTCGCCTACAGCTGCTGGACCTATCA
AGACATATTCCCCAGACCTGATAGTTCATCCAATCCTCCGCCAAGACGCGTCAGTCTTACGTATCTTGTTGGATC
CCTCACATTGTCTGATCCTCGACATAACAGGCCCGTCGAGACAGTAAAATCCGAACTAGATTCTCTCTTCTCCAG
ACTCCACGTTCTCGTCATCGGACCAGGTCTCGGAAGAGAAGATTACATGCAAAAATTCGCACGTACAGCTGTCAG
CATTGCTCGTAACCGTGGAATGTTTCTCGTCCTCGACGCCGACGCACTTTTCTTGGTTGGAAAAGACATATCCAT
AATTCAGGGATATCGTCGTGCTATTCTTACACCCAATCTCGTTGAATTCAAACGTCTTGCTGATCAAGTTGGCGT
TAGTCCGGATACTCCAGTCGATCAAAGGGCTCGATTGTTGTCCAAGTTACTTGGAGGTGTTACGGTACTCCAGAA
AGGAGCTCACGACATGATTGTTACCGATACTCGAGGACCGGATGCCGATCTCGCAGCGAGTCAATTGTCTGGGGC
AGACCCCGAGAAGGAAGAATTCTGTGAGCTTGTCAAAGTCGATGTGCCTGGTGGATATAAGAGATGTGGTGGACA
AGGCGATATTCTAAGCGGTACCGTCGGTACATTCCTTGCATGGGGTTTAAGCTATGAAGAAGGGGCATTTGGGTA
AGCGTTGGATTGGATAGTGCAACAATATATGCTCTAATAATGGACGCTATCAGAGATAAAAGCATTCCGGCATCT
CGAGTACCTCTCCTTGCCGCCGTTGGTGGAAGTATGGTTACCCGTACGGCCAGTCGTCTGGCTTTCAAGAAGGCA
GGAAGAAGTTTGGTAACTCAGGATATGCTTTCCGAGATCGGTTACGCGTTTGCAGAAACATTTGGTGATGTCGAA
CAATTTGACGGAAAACTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail