Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|091710
Gene name
Locationscaffold_06:899957..902250
Strand-
Gene length (bp)2293
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09507 CDC27 DNA polymerase subunit Cdc27 5.3E-35 20 598

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9EQ28|DPOD3_MOUSE DNA polymerase delta subunit 3 OS=Mus musculus GN=Pold3 PE=1 SV=2 1 334 2.0E-06

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0006260 DNA replication Yes
GO:0043625 delta DNA polymerase complex Yes
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:1990234 transferase complex No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0042575 DNA polymerase complex No
GO:0008152 metabolic process No
GO:0043229 intracellular organelle No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0043226 organelle No
GO:0009987 cellular process No
GO:0140535 intracellular protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:0061695 transferase complex, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1902494 catalytic complex No
GO:0110165 cellular anatomical entity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|091710
MTTQNIEDYLTKQLFISRNIVTYRSLSREFSIHVNVAKNELAAFHAKTANSRDQVCCATYIVSGLVLDGSGKGKL
KESQSSSDMDVDMGYGFTPTQTPDYGFAKGSDQYGGDIVVQVRMTVVGEDKLEDTKAKYEKVTSVHVYSLSPSPI
RDADLLCEPTRQIREIDNRKGIEMAKAVGRIIGADIQMLEGGIKAKTKTAATTNAQPSVPKLKAGPSISTAAVTK
SEDKGKESVKEESKKPKPTGKLNFFAPKAPKEKEKGKETSSKDPVEPNRKMFFGAASKSLASTGKVKEATPTSIV
PPRKESKKVEPTKRGTKRKPAAGGLSDEQDEETKSNSAAPSGPPSRFSSKPPSTRSSPQPAKLSSKPRIITSSDD
EDDNEPPMKKTRRLPRRKAIPGSDDESGHDSKATSEAREALKSMMDLDDDKVERVARKAKVGALEEKVETELEQE
VPEDVKKDEDVEMSDDRAAKPKPKLRKKKKVVPVGRNGLKKRPVTKTQTVKTDDGWTVCDYTSYESCEEVEETNE
PVPVKKGKRGPAKPLKEKKEMSKMAGPGGAAVDATASGEDGKSESNTTIKMSTSRPAARTKGGQKQKTLGTFFAP
QRPKK*
Coding >Agabi119p4|091710
ATGACAACACAAAACATCGAAGACTATCTAACAAAGCAACTCTTCATCTCCAGGAACATCGTGACCTACCGCTCG
TTAAGTAGGGAATTTAGTATTCACGTTAATGTTGCCAAAAATGAACTGGCAGCATTTCACGCCAAGACCGCTAAC
TCGCGCGACCAAGTGTGTTGCGCGACATACATTGTCAGCGGGCTAGTATTGGACGGTTCGGGAAAGGGAAAACTT
AAAGAGAGTCAAAGCTCGAGTGACATGGATGTCGACATGGGCTACGGATTCACACCGACGCAAACACCGGACTAT
GGGTTCGCTAAAGGTAGTGATCAATATGGAGGAGATATTGTGGTCCAGGTCAGAATGACTGTAGTTGGTGAGGAC
AAGCTCGAAGATACGAAAGCGAAGTATGAAAAAGTCACTTCGGTGCATGTCTATAGTTTGAGCCCTTCTCCAATT
CGAGATGCAGATTTGCTTTGTGAACCCACGCGGCAAATCAGGGAAATCGATAACCGGAAGGGAATTGAGATGGCT
AAGGCTGTTGGGAGGATTATTGGAGCAGATATACAGATGCTGGAGGGTGGTATAAAGGCCAAAACCAAAACGGCT
GCTACCACCAACGCTCAGCCATCAGTCCCGAAGCTAAAGGCGGGGCCAAGCATTTCCACCGCCGCAGTTACAAAA
AGCGAAGATAAAGGCAAAGAGTCTGTTAAAGAAGAGTCAAAGAAACCCAAGCCTACCGGGAAATTAAACTTTTTT
GCTCCCAAGGCTCCCAAAGAGAAAGAGAAAGGAAAGGAAACATCATCCAAAGATCCTGTGGAGCCGAATAGGAAA
ATGTTTTTCGGTGCAGCGTCGAAATCTTTAGCTTCTACAGGTAAGGTTAAAGAAGCCACACCTACGTCAATAGTA
CCACCCCGGAAAGAATCTAAGAAAGTGGAGCCAACAAAGCGAGGGACAAAAAGAAAACCAGCTGCTGGTGGTCTA
TCAGATGAGCAAGATGAGGAAACAAAGTCTAACTCCGCCGCTCCATCAGGGCCACCTTCCCGTTTCTCTTCTAAA
CCTCCATCTACAAGATCTTCTCCCCAGCCGGCGAAGCTTTCGTCCAAACCGCGGATTATAACATCATCTGATGAT
GAAGATGATAATGAGCCGCCAATGAAGAAAACTCGGAGACTGCCACGGCGCAAAGCTATTCCTGGCTCCGATGAT
GAGAGCGGGCATGATTCGAAAGCCACTAGTGAAGCGAGGGAAGCTCTAAAATCCATGATGGACTTAGACGACGAT
AAAGTGGAAAGAGTTGCTAGAAAGGCTAAGGTGGGGGCTTTGGAGGAGAAAGTTGAAACAGAGTTGGAACAGGAA
GTACCGGAAGATGTAAAGAAAGATGAGGATGTAGAGATGTCTGATGATAGAGCGGCAAAACCAAAGCCAAAACTG
AGAAAGAAGAAAAAAGTCGTACCAGTGGGTCGGAACGGCCTGAAGAAGCGTCCTGTGACGAAAACTCAGACGGTC
AAGACAGACGATGGTTGGACTGTATGTGATTATACTTCCTATGAATCCTGCGAAGAAGTGGAGGAGACGAACGAA
CCTGTACCCGTGAAAAAGGGCAAGCGAGGCCCGGCAAAACCTCTCAAAGAAAAAAAAGAAATGTCTAAGATGGCT
GGACCAGGGGGCGCTGCTGTCGATGCAACTGCATCTGGGGAGGATGGCAAGTCTGAATCGAATACGACAATCAAG
ATGTCTACAAGTCGACCTGCGGCTAGGACAAAGGGCGGTCAGAAGCAAAAAACACTGGGTACATTTTTCGCACCG
CAAAGGCCCAAGAAGTAG
Transcript >Agabi119p4|091710
ATGACAACACAAAACATCGAAGACTATCTAACAAAGCAACTCTTCATCTCCAGGAACATCGTGACCTACCGCTCG
TTAAGTAGGGAATTTAGTATTCACGTTAATGTTGCCAAAAATGAACTGGCAGCATTTCACGCCAAGACCGCTAAC
TCGCGCGACCAAGTGTGTTGCGCGACATACATTGTCAGCGGGCTAGTATTGGACGGTTCGGGAAAGGGAAAACTT
AAAGAGAGTCAAAGCTCGAGTGACATGGATGTCGACATGGGCTACGGATTCACACCGACGCAAACACCGGACTAT
GGGTTCGCTAAAGGTAGTGATCAATATGGAGGAGATATTGTGGTCCAGGTCAGAATGACTGTAGTTGGTGAGGAC
AAGCTCGAAGATACGAAAGCGAAGTATGAAAAAGTCACTTCGGTGCATGTCTATAGTTTGAGCCCTTCTCCAATT
CGAGATGCAGATTTGCTTTGTGAACCCACGCGGCAAATCAGGGAAATCGATAACCGGAAGGGAATTGAGATGGCT
AAGGCTGTTGGGAGGATTATTGGAGCAGATATACAGATGCTGGAGGGTGGTATAAAGGCCAAAACCAAAACGGCT
GCTACCACCAACGCTCAGCCATCAGTCCCGAAGCTAAAGGCGGGGCCAAGCATTTCCACCGCCGCAGTTACAAAA
AGCGAAGATAAAGGCAAAGAGTCTGTTAAAGAAGAGTCAAAGAAACCCAAGCCTACCGGGAAATTAAACTTTTTT
GCTCCCAAGGCTCCCAAAGAGAAAGAGAAAGGAAAGGAAACATCATCCAAAGATCCTGTGGAGCCGAATAGGAAA
ATGTTTTTCGGTGCAGCGTCGAAATCTTTAGCTTCTACAGGTAAGGTTAAAGAAGCCACACCTACGTCAATAGTA
CCACCCCGGAAAGAATCTAAGAAAGTGGAGCCAACAAAGCGAGGGACAAAAAGAAAACCAGCTGCTGGTGGTCTA
TCAGATGAGCAAGATGAGGAAACAAAGTCTAACTCCGCCGCTCCATCAGGGCCACCTTCCCGTTTCTCTTCTAAA
CCTCCATCTACAAGATCTTCTCCCCAGCCGGCGAAGCTTTCGTCCAAACCGCGGATTATAACATCATCTGATGAT
GAAGATGATAATGAGCCGCCAATGAAGAAAACTCGGAGACTGCCACGGCGCAAAGCTATTCCTGGCTCCGATGAT
GAGAGCGGGCATGATTCGAAAGCCACTAGTGAAGCGAGGGAAGCTCTAAAATCCATGATGGACTTAGACGACGAT
AAAGTGGAAAGAGTTGCTAGAAAGGCTAAGGTGGGGGCTTTGGAGGAGAAAGTTGAAACAGAGTTGGAACAGGAA
GTACCGGAAGATGTAAAGAAAGATGAGGATGTAGAGATGTCTGATGATAGAGCGGCAAAACCAAAGCCAAAACTG
AGAAAGAAGAAAAAAGTCGTACCAGTGGGTCGGAACGGCCTGAAGAAGCGTCCTGTGACGAAAACTCAGACGGTC
AAGACAGACGATGGTTGGACTGTATGTGATTATACTTCCTATGAATCCTGCGAAGAAGTGGAGGAGACGAACGAA
CCTGTACCCGTGAAAAAGGGCAAGCGAGGCCCGGCAAAACCTCTCAAAGAAAAAAAAGAAATGTCTAAGATGGCT
GGACCAGGGGGCGCTGCTGTCGATGCAACTGCATCTGGGGAGGATGGCAAGTCTGAATCGAATACGACAATCAAG
ATGTCTACAAGTCGACCTGCGGCTAGGACAAAGGGCGGTCAGAAGCAAAAAACACTGGGTACATTTTTCGCACCG
CAAAGGCCCAAGAAGTAG
Gene >Agabi119p4|091710
ATGACAACACAAAACATCGAAGACTATCTAACAAAGCAACTCTTCATCTCCAGGAACATCGTGAGTGAATCATAT
TGGCTATTTGAGCTTGAGCTGAATATCTTTTGCTTTATTGAAAGGTGACCTACCGCTCGTTAAGTAGGGAATTTA
GTATTCACGTTAATGTTGCCAAAAAGTTCGTTTTCATCTCTGGGCCGAATGATCTCTTCGACCAAGTATAACGCA
CAACTAATCGCCGATTAGTGAACTGGCAGCATTTCACGCCAAGACCGCTAACTCGCGCGACCAAGTGTGTTGCGC
GACATACATTGTCAGCGGGCTAGTATTGGACGGTTCGGGAAAGGGAAAACTTAAAGAGAGTCAAAGCTCGAGTGA
CATGGATGTCGACATGGGCTACGGATTCACACCGACGCAAACACCGGACTATGGGTTCGCTAAAGGTAGTGATCA
ATATGGAGGAGATATTGTGGTCCAGGTCAGAATGACTGTAGTTGGTGAGGACAAGCTCGAAGGTATGCATATATG
CTAATCATAAGAAGTTGTTGACTTTGATTCCTTCGGTATCGTGAATAAAATTTACCAGATACGAAAGCGAAGTAT
GAAAAAGTCACTTCGGTGCATGTCTATAGTTTGAGCCCTTCTCCAATTCGAGTGCGTGTTTACCGTTTTCCGTAT
CCTACTTGAATTTCATTCATGGGTTATGCTAGGATGCAGATTTGCTTTGTGAACCCACGCGGCAAATCAGGGAAA
TCGATAACCGGAAGGGAATTGAGATGGCTAAGGCTGTTGGGAGGATTATTGGAGCAGATATACAGGTTTGGTATT
TTGATGTTCAATGAACGTCGTCTAACGCATATCCATAGATGCTGGAGGGTGGTATAAAGGCCAAAACCAAAACGG
CTGCTACCACCAACGCTCAGCCATCAGTCCCGAAGCTAAAGGCGGGGCCAAGCATTTCCACCGCCGCAGTTACAA
AAAGCGAAGATAAAGGCAAAGAGTCTGTTAAAGAAGAGTCAAAGAAACCCAAGCCTACCGGGAAATTAAACTTTT
TTGCTCCCAAGGCTCCCAAAGAGAAAGAGAAAGGAAAGGAAACATCATCCAAAGATCCTGTGGAGCCGAATAGGA
AAATGTTTTTCGGTGCAGCGTCGAAATCTTTAGCTTCTACAGGTAAGGTTAAAGAAGCCACACCTACGTCAATAG
TACCACCCCGGAAAGAATCTAAGAAAGTGGAGCCAACAAAGGTACGCGTGTTTACATGGAATATTCAATTAAATC
ATAAAAATTCTTTATAGCGAGGGACAAAAAGAAAACCAGCTGCTGGTGGTCTATCAGATGAGCAAGATGAGGAAA
CAAAGTCTAACTCCGCCGCTCCATCAGGGCCACCTTCCCGTTTCTCTTCTAAACCTCCATCTACAAGATCTTCTC
CCCAGCCGGCGAAGCTTTCGTCCAAACCGCGGATTATAACATCATCTGATGATGAAGATGATAATGAGCCGCCAA
TGAAGAAAACTCGGAGACTGCCACGGCGCAAAGCTATTCCTGGCTCCGATGATGAGAGCGGGCATGATTCGAAAG
CCACTAGTGAAGCGAGGGAAGCTCTAAAATCCATGATGGACTTAGACGACGGTATGTATTATCTAAATCTCTCTT
CTTTTTGGAGTTTCAATGTGTCATACATTACACAGATAAAGTGGAAAGAGTTGCTAGAAAGGCTAAGGTGGGGGC
TTTGGAGGAGAAAGTTGAAACAGAGTTGGAACAGGAAGTACCGGAAGATGTAAAGAAAGATGAGGATGTAGAGAT
GTCTGATGATAGAGCGGCAAAACCAAAGCCAAAACTGAGAAAGAAGAAAAAAGTCGTACCAGTGGGTCGGAACGG
CCTGAAGAAGCGTCCTGTGACGAAAACTCAGACGGTCAAGACAGACGATGGTTGGAGTATGTGGCATCCCTTTGT
CTACCTGTCAGAACAGTGACTCACCCGCGGATTTCGGAACTCAGCTGTATGTGATTATACTTCCTATGAATCCTG
CGAAGAAGTGGAGGAGACGAACGAACCTGTACCCGTGAAAAAGGGCAAGCGAGGCCCGGCAAAACCTCTCAAAGA
AAAAAAAGAAATGTCTAAGATGGCTGGACCAGGGGGCGCTGCTGTCGATGCAACTGCATCTGGGGAGGATGGCAA
GTCTGAATCGAATACGACAATCAAGATGTCTACAAGTCGACCTGCGGCTAGGACAAAGGGCGGTCAGAAGCAAAA
AACACTGGGTACATTTTTCGCACCGCAAAGGCCCAAGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail