Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|091550
Gene name
Locationscaffold_06:855748..856435
Strand-
Gene length (bp)687
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05241 EBP EXPERA (EXPanded EBP superfamily) 6.6E-26 35 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3MHW7|TMM97_BOVIN Transmembrane protein 97 OS=Bos taurus GN=TMEM97 PE=2 SV=1 8 148 4.0E-12
sp|Q6DFQ5|TMM97_XENTR Transmembrane protein 97 OS=Xenopus tropicalis GN=tmem97 PE=2 SV=1 1 148 5.0E-12
sp|Q4R8A8|TMM97_MACFA Transmembrane protein 97 OS=Macaca fascicularis GN=Tmem97 PE=2 SV=2 8 156 7.0E-12
sp|Q5BJF2|TMM97_HUMAN Transmembrane protein 97 OS=Homo sapiens GN=TMEM97 PE=1 SV=1 8 156 8.0E-12
sp|Q5U3Y7|TMM97_RAT Transmembrane protein 97 OS=Rattus norvegicus GN=Tmem97 PE=2 SV=1 8 148 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3MHW7|TMM97_BOVIN Transmembrane protein 97 OS=Bos taurus GN=TMEM97 PE=2 SV=1 8 148 4.0E-12
sp|Q6DFQ5|TMM97_XENTR Transmembrane protein 97 OS=Xenopus tropicalis GN=tmem97 PE=2 SV=1 1 148 5.0E-12
sp|Q4R8A8|TMM97_MACFA Transmembrane protein 97 OS=Macaca fascicularis GN=Tmem97 PE=2 SV=2 8 156 7.0E-12
sp|Q5BJF2|TMM97_HUMAN Transmembrane protein 97 OS=Homo sapiens GN=TMEM97 PE=1 SV=1 8 156 8.0E-12
sp|Q5U3Y7|TMM97_RAT Transmembrane protein 97 OS=Rattus norvegicus GN=Tmem97 PE=2 SV=1 8 148 1.0E-10
sp|Q10255|YD27_SCHPO Uncharacterized membrane protein SPAC56F8.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.07 PE=3 SV=3 1 165 2.0E-10
sp|Q8VD00|TMM97_MOUSE Transmembrane protein 97 OS=Mus musculus GN=Tmem97 PE=1 SV=1 8 148 4.0E-10
sp|Q12155|YL050_YEAST Uncharacterized membrane protein YLR050C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR050C PE=1 SV=1 57 157 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 3 25 22
2 68 90 22
3 97 119 22
4 139 161 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|091550
MDLLYFGFFASHLFASLLLDLQWLYPASLVPKSLRALNEYYIVLSGDPLMGALAGLKHDFGMTWFKTFVTMEAFF
QVPVFILGLSALWKGSKKIYPLLLIYATSSATTTLPCLIYILSLPGPTPTTTPLDHTLTFEQRLVLLSGYGPFFL
VPLIMVFDFGSRLQKFVSQKPEQKLD*
Coding >Agabi119p4|091550
ATGGACTTGCTTTATTTCGGGTTCTTTGCGTCCCATTTATTTGCATCTCTTTTACTCGATCTTCAATGGTTATAC
CCAGCTTCCCTCGTCCCCAAGTCATTGCGAGCGTTGAATGAATACTACATAGTGCTCTCGGGCGATCCGTTGATG
GGAGCACTCGCTGGCCTTAAACATGATTTTGGTATGACTTGGTTCAAAACATTTGTCACAATGGAAGCGTTTTTC
CAAGTCCCAGTCTTTATACTCGGCTTGTCTGCTCTGTGGAAAGGCTCCAAGAAAATATACCCGCTCCTGCTGATC
TATGCCACATCCTCTGCAACCACAACACTTCCGTGCCTTATCTATATTTTGTCACTCCCAGGACCTACCCCAACC
ACAACTCCTCTAGACCATACCCTCACATTCGAACAGCGCCTCGTACTACTTTCAGGCTACGGCCCATTCTTCTTG
GTTCCTTTGATCATGGTCTTTGACTTTGGTAGTCGTCTGCAGAAGTTTGTCTCACAAAAGCCCGAACAGAAGTTG
GACTGA
Transcript >Agabi119p4|091550
ATGGACTTGCTTTATTTCGGGTTCTTTGCGTCCCATTTATTTGCATCTCTTTTACTCGATCTTCAATGGTTATAC
CCAGCTTCCCTCGTCCCCAAGTCATTGCGAGCGTTGAATGAATACTACATAGTGCTCTCGGGCGATCCGTTGATG
GGAGCACTCGCTGGCCTTAAACATGATTTTGGTATGACTTGGTTCAAAACATTTGTCACAATGGAAGCGTTTTTC
CAAGTCCCAGTCTTTATACTCGGCTTGTCTGCTCTGTGGAAAGGCTCCAAGAAAATATACCCGCTCCTGCTGATC
TATGCCACATCCTCTGCAACCACAACACTTCCGTGCCTTATCTATATTTTGTCACTCCCAGGACCTACCCCAACC
ACAACTCCTCTAGACCATACCCTCACATTCGAACAGCGCCTCGTACTACTTTCAGGCTACGGCCCATTCTTCTTG
GTTCCTTTGATCATGGTCTTTGACTTTGGTAGTCGTCTGCAGAAGTTTGTCTCACAAAAGCCCGAACAGAAGTTG
GACTGA
Gene >Agabi119p4|091550
ATGGACTTGCTTTATTTCGGGTTCTTTGCGGTGCGTCGACTCCCAGAAACCCACCACCTTGATGTTCTTACATAA
ATTCTAGTCCCATTTATTTGCATCTCTTTTACTCGATCTTCAATGGTTATACCCAGCTTCCCTCGTCCCCAAGTC
ATTGCGAGCGTTGAATGAATACTACATAGTGCTCTCGGGCGATCCGTTGATGGGAGCACTCGCTGGCCTTAAACA
TGATTTTGGTATGACTTGGTTCAAAACATTTGTCACAATGGAAGCGTAAGCCGCCTTACACACTGGCATTTGATA
CCGTTAATTATACTGTTTTACAGGTTTTTCCAAGTCCCAGTCTTTATACTCGGCTTGTCTGCTCTGTGGAAAGGT
GAGGACAACATCGTACAAGCTACTCCTAGTAGTTGCTCATTTCGTTTAGGCTCCAAGAAAATATACCCGCTCCTG
CTGATCTATGCCACATCCTCTGCAACCACAACACTTCCGTGCCTTATCTATATTTTGTCACTCCCAGGACCTACC
CCAACCACAACTCCTCTAGACCATACCCTCACATTCGAACAGCGCCTCGTACTACTTTCAGGCTACGGCCCATTC
TTCTTGGTTCCTTTGATCATGGTCTTTGACTTTGGTAGTCGTCTGCAGAAGTTTGTCTCACAAAAGCCCGAACAG
AAGTTGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail