Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|091390
Gene name
Locationscaffold_06:798010..799121
Strand+
Gene length (bp)1111
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 3.6E-42 29 214
PF00734 CBM_1 Fungal cellulose binding domain 3.3E-11 249 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 34 279 1.0E-88
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 34 215 2.0E-80
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 234 279 9.0E-13
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 244 279 6.0E-11
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 243 279 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 34 279 1.0E-88
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 34 215 2.0E-80
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 234 279 9.0E-13
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 244 279 6.0E-11
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 243 279 3.0E-10
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 221 279 2.0E-09
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 234 279 2.0E-08
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 246 279 5.0E-08
sp|Q9UV68|XYNC_NEOPA Endo-1,4-beta-xylanase C OS=Neocallimastix patriciarum GN=xynC PE=1 SV=1 243 278 7.0E-08
sp|G4NBX2|CE12C_MAGO7 Endoglucanase cel12C OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel12C PE=3 SV=1 245 278 1.0E-07
sp|A8TGA1|XYS20_NEOPA Endo-1,4-beta-xylanase S20 OS=Neocallimastix patriciarum GN=xynS20 PE=1 SV=1 245 278 1.0E-07
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 244 279 3.0E-07
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 249 279 3.0E-07
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 245 279 4.0E-07
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 244 279 7.0E-07
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 234 279 7.0E-07
sp|Q7SA23|GUX1A_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 220 279 1.0E-06
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 245 279 1.0E-06
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 249 279 1.0E-06
sp|P62695|GUX1_TRIKO Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 242 279 2.0E-06
sp|P62694|GUX1_HYPJE Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 242 279 2.0E-06
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 245 279 2.0E-06
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 249 279 3.0E-06
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 246 279 4.0E-06
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 244 279 5.0E-06
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 240 279 6.0E-06
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 248 279 7.0E-06
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 248 279 7.0E-06
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 248 279 7.0E-06
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 246 279 7.0E-06
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 246 279 9.0E-06
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 245 279 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0030248 cellulose binding Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030247 polysaccharide binding No
GO:0030246 carbohydrate binding No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|091390
MHTAGCPGTIKSNSCLLLTSRCKSSCRTVPTGPVVNSIIGAFPGATSEAINYPACGGQAQCGGVSYANSVVQGVA
AVASQVNSFNQRCPSTVLVLVGYSQGGQIFDDAYCGGGDTNEGIFDTSIPISTAAQAKIAAAIFMGDPRHIPGLS
YNVGTCQASGFAPRPAGFQCPYATNIKSYCDAADPYCCNGNDANTHQGYANEYGSAALTFVRGKVNALLNGSSPT
MPPGNTTTPPPSSTPPPGNCSAMWGQCGGMGWTGPQCCSSGTCQAINPYYSQCL*
Coding >Agabi119p4|091390
ATGCACACAGCTGGCTGTCCAGGAACTATAAAATCGAACAGTTGCCTCCTTCTTACTTCTAGGTGCAAGTCTAGT
TGCCGCACAGTGCCCACAGGGCCCGTCGTCAACTCCATCATTGGTGCCTTCCCTGGAGCAACCTCTGAAGCTATC
AACTACCCTGCCTGTGGCGGCCAAGCACAGTGTGGTGGTGTCAGCTACGCTAACTCTGTCGTTCAGGGTGTTGCC
GCTGTCGCCAGCCAGGTCAACTCATTCAACCAGCGGTGCCCCAGCACCGTGCTTGTTCTAGTAGGATACTCCCAG
GGTGGTCAAATCTTTGATGATGCATACTGTGGCGGAGGCGATACTAACGAAGGCATCTTCGACACATCCATTCCC
ATTTCCACAGCTGCTCAAGCTAAAATCGCTGCAGCAATCTTCATGGGTGACCCGCGGCACATCCCAGGCTTGTCT
TACAACGTTGGGACATGTCAAGCGAGTGGTTTCGCACCTCGTCCCGCTGGCTTCCAATGTCCGTATGCGACTAAC
ATTAAGTCATATTGCGATGCTGCCGACCCATACTGCTGCAACGGAAACGATGCCAACACCCACCAAGGCTACGCT
AATGAATACGGCTCTGCAGCGCTTACATTTGTCAGGGGCAAGGTGAACGCCCTGCTCAACGGTTCGTCTCCCACT
ATGCCTCCGGGCAATACCACCACCCCGCCACCGAGTAGCACTCCTCCCCCTGGCAATTGTTCTGCTATGTGGGGA
CAATGTGGCGGAATGGGATGGACTGGTCCTCAATGCTGCTCATCTGGTACTTGTCAGGCGATCAATCCCTACTAT
TCCCAGTGTCTCTAG
Transcript >Agabi119p4|091390
ATGCACACAGCTGGCTGTCCAGGAACTATAAAATCGAACAGTTGCCTCCTTCTTACTTCTAGGTGCAAGTCTAGT
TGCCGCACAGTGCCCACAGGGCCCGTCGTCAACTCCATCATTGGTGCCTTCCCTGGAGCAACCTCTGAAGCTATC
AACTACCCTGCCTGTGGCGGCCAAGCACAGTGTGGTGGTGTCAGCTACGCTAACTCTGTCGTTCAGGGTGTTGCC
GCTGTCGCCAGCCAGGTCAACTCATTCAACCAGCGGTGCCCCAGCACCGTGCTTGTTCTAGTAGGATACTCCCAG
GGTGGTCAAATCTTTGATGATGCATACTGTGGCGGAGGCGATACTAACGAAGGCATCTTCGACACATCCATTCCC
ATTTCCACAGCTGCTCAAGCTAAAATCGCTGCAGCAATCTTCATGGGTGACCCGCGGCACATCCCAGGCTTGTCT
TACAACGTTGGGACATGTCAAGCGAGTGGTTTCGCACCTCGTCCCGCTGGCTTCCAATGTCCGTATGCGACTAAC
ATTAAGTCATATTGCGATGCTGCCGACCCATACTGCTGCAACGGAAACGATGCCAACACCCACCAAGGCTACGCT
AATGAATACGGCTCTGCAGCGCTTACATTTGTCAGGGGCAAGGTGAACGCCCTGCTCAACGGTTCGTCTCCCACT
ATGCCTCCGGGCAATACCACCACCCCGCCACCGAGTAGCACTCCTCCCCCTGGCAATTGTTCTGCTATGTGGGGA
CAATGTGGCGGAATGGGATGGACTGGTCCTCAATGCTGCTCATCTGGTACTTGTCAGGCGATCAATCCCTACTAT
TCCCAGTGTCTCTAG
Gene >Agabi119p4|091390
ATGCACACAGCTGGCTGTCCAGGAACTATAAAATCGAACAGTTGGTCAGTCATCGTTTACAGGCTCGTCATTTTA
TAATGTCGCTCATCCGTGTAGCCTCCTTCTTACTTCTAGGTGCAAGTCTAGTTGCCGCACAGTGCCCACAGGTGC
ACATATTCGGTGCCCGCGAAACTACTGTTCCCCCTGGGTACGGTACATCAGGGCCCGTCGTCAACTCCATCATTG
GTGCCTTCCCTGGAGCAACCTCTGAAGCTATCAACTACCCTGCCTGTGGCGGCCAAGCACAGTGTGGTGGTGTCA
GCTACGCTAACTCTGTCGTTCAGGGTGTTGCCGCTGTCGCCAGCCAGGTCAACTCATTCAACCAGCGGTGCCCCA
GCACCGTGCTTGTTCTAGTAGGATACTCCCAGGTATGAATAAACCTGTATTCTTGAAAGACTGATTGCTGATATG
AATGCCTCTAAGGGTGGTCAAATCTTTGATGATGCATACTGTGGCGGAGGCGATACTAACGAAGGCATCTTCGAC
ACATCCATTCCCATTTCCACAGCTGCTCAAGCTAAAATCGCTGCAGCAATCTTCATGGGTGACCCGCGGCACATC
CCAGGCTTGTCTTACAACGTTGGGACATGTCAAGCGAGTGGTGTTCGTGCCATGCTCATCGTCTCTCGTTCCCAT
GTGCTAATCATGTCCTTAGTTCGCACCTCGTCCCGCTGGCTTCCAATGTCCGTATGCGACTAACATTAAGTCATA
TTGCGATGCTGCCGACCCATACTGCTGCAACGGAAACGATGCCAACACCCACCAAGGCTACGCTAATGAATACGG
CTCTGCAGCGCTTACATTTGTCAGGGGCAAGGTGAACGCCCTGCTCAACGGTTCGTCTCCCACTATGCCTCCGGG
CAATACCACCACCCCGCCACCGAGTAGCACTCCTCCCCCTGGCAATGTCAGTAACACAATAAAACTTTGAAAGAC
TTCAATTAACTATTAGCTGTCCTTCTAGTGTTCTGCTATGTGGGGACAATGTGGCGGAATGGGATGGACTGGTCC
TCAATGCTGCTCATCTGGTACTTGTCAGGCGATCAATCCCTACTATTCCCAGTGTCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail