Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|091360
Gene name
Locationscaffold_06:783983..785570
Strand+
Gene length (bp)1587
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 3.2E-56 59 364

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 58 368 2.0E-74
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 30 368 2.0E-72
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 45 368 8.0E-45
sp|Q6L8G0|ZIP5_ORYSJ Zinc transporter 5 OS=Oryza sativa subsp. japonica GN=ZIP5 PE=2 SV=1 45 368 4.0E-44
sp|O23039|ZIP5_ARATH Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1 43 368 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 58 368 2.0E-74
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 30 368 2.0E-72
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 45 368 8.0E-45
sp|Q6L8G0|ZIP5_ORYSJ Zinc transporter 5 OS=Oryza sativa subsp. japonica GN=ZIP5 PE=2 SV=1 45 368 4.0E-44
sp|O23039|ZIP5_ARATH Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1 43 368 2.0E-42
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 172 368 1.0E-41
sp|Q8W246|ZIP7_ARATH Zinc transporter 7 OS=Arabidopsis thaliana GN=ZIP7 PE=2 SV=1 41 368 2.0E-40
sp|Q6L8G1|IRT2_ORYSJ Fe(2+) transport protein 2 OS=Oryza sativa subsp. japonica GN=IRT2 PE=2 SV=1 56 368 9.0E-40
sp|O81123|ZIP1_ARATH Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1 17 368 5.0E-38
sp|A3BI11|ZIP8_ORYSJ Zinc transporter 8 OS=Oryza sativa subsp. japonica GN=ZIP8 PE=2 SV=1 60 368 5.0E-38
sp|Q8W245|ZIP10_ARATH Probable zinc transporter 10 OS=Arabidopsis thaliana GN=ZIP10 PE=1 SV=2 42 368 6.0E-38
sp|Q75HB1|IRT1_ORYSJ Fe(2+) transport protein 1 OS=Oryza sativa subsp. japonica GN=IRT1 PE=2 SV=1 56 368 2.0E-37
sp|Q8S3W4|ZIP8_ARATH Probable zinc transporter 8 OS=Arabidopsis thaliana GN=ZIP8 PE=2 SV=1 42 368 5.0E-37
sp|Q7XLD4|ZIP3_ORYSJ Zinc transporter 3 OS=Oryza sativa subsp. japonica GN=ZIP3 PE=1 SV=2 44 368 1.0E-35
sp|Q38856|IRT1_ARATH Fe(2+) transport protein 1 OS=Arabidopsis thaliana GN=IRT1 PE=1 SV=2 56 368 6.0E-35
sp|Q0DHE3|ZIP9_ORYSJ Zinc transporter 9 OS=Oryza sativa subsp. japonica GN=ZIP9 PE=3 SV=3 50 368 2.0E-33
sp|O04089|ZIP4_ARATH Zinc transporter 4, chloroplastic OS=Arabidopsis thaliana GN=ZIP4 PE=2 SV=1 60 368 3.0E-33
sp|Q9FIS2|ZIP12_ARATH Probable zinc transporter 12 OS=Arabidopsis thaliana GN=ZIP12 PE=3 SV=1 41 368 1.0E-31
sp|O81850|IRT2_ARATH Fe(2+) transport protein 2 OS=Arabidopsis thaliana GN=IRT2 PE=1 SV=1 56 368 2.0E-31
sp|O64738|ZIP6_ARATH Zinc transporter 6, chloroplastic OS=Arabidopsis thaliana GN=ZIP6 PE=3 SV=1 60 368 4.0E-31
sp|Q8LE59|IRT3_ARATH Fe(2+) transport protein 3, chloroplastic OS=Arabidopsis thaliana GN=IRT3 PE=2 SV=3 60 368 5.0E-30
sp|O82643|ZIP9_ARATH Zinc transporter 9 OS=Arabidopsis thaliana GN=ZIP9 PE=2 SV=1 98 368 2.0E-29
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 39 181 3.0E-26
sp|Q6L8F7|ZIP7_ORYSJ Zinc transporter 7 OS=Oryza sativa subsp. japonica GN=ZIP7 PE=2 SV=1 44 368 1.0E-24
sp|Q5Z653|ZIP10_ORYSJ Zinc transporter 10 OS=Oryza sativa subsp. japonica GN=ZIP10 PE=3 SV=2 210 357 4.0E-22
sp|Q6L8F9|ZIP6_ORYSJ Zinc transporter 6 OS=Oryza sativa subsp. japonica GN=ZIP6 PE=2 SV=1 216 368 1.0E-20
sp|Q6ZJ91|ZIP4_ORYSJ Zinc transporter 4 OS=Oryza sativa subsp. japonica GN=ZIP4 PE=2 SV=1 202 368 3.0E-19
sp|Q99K24|S39A3_MOUSE Zinc transporter ZIP3 OS=Mus musculus GN=Slc39a3 PE=1 SV=1 62 362 2.0E-07
sp|Q9BRY0|S39A3_HUMAN Zinc transporter ZIP3 OS=Homo sapiens GN=SLC39A3 PE=1 SV=2 62 362 4.0E-07
sp|Q5E960|S39A3_BOVIN Zinc transporter ZIP3 OS=Bos taurus GN=SLC39A3 PE=2 SV=1 62 362 1.0E-06
sp|Q5U1X7|S39A3_RAT Zinc transporter ZIP3 OS=Rattus norvegicus GN=Slc39a3 PE=1 SV=1 62 362 2.0E-06
sp|Q9LTH9|ZIP2_ARATH Zinc transporter 2 OS=Arabidopsis thaliana GN=ZIP2 PE=2 SV=1 101 367 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 95 114 19
3 134 156 22
4 211 233 22
5 272 294 22
6 307 329 22
7 344 366 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|091360
MNLFRLKLAPPFGDPSIIFLYPSCATMTTFVNAHRHVFLPRDEDEVDCSEGGGDDRFLGLRIGSIFIILACATCG
ALFPVIAKRSSCLHLPRSAYAFAKYFGSGVIIATAFIHLLDPAIEELGSPCLSAKWGEYPYALALCMLSMFCVFL
VELLALRWGTARLRKLGLVQADPHGHGDGGKQKDQEEARSESDLGIDIAGNSITEKVLAQIVGVAILEFGVVLHS
ILIGLTLAVDQNFKILFIVLIFHQSFEGLGLGSRLALMKLEPKYHWVPYVGALVYGITTPVGIAAGLGVRTTYNP
GTASASIVSGVLDALSAGILLYTGLVELLAHEFLFNKEMMESSGGRLAFAVLAMFLGCGIMALLGRWA*
Coding >Agabi119p4|091360
ATGAACCTGTTTCGGCTCAAATTAGCTCCACCGTTTGGCGATCCATCCATCATCTTCTTATACCCTTCTTGTGCC
ACGATGACTACTTTTGTGAACGCTCACCGCCATGTATTTCTACCGCGAGATGAAGATGAAGTGGACTGTAGTGAA
GGGGGAGGGGACGACCGATTTCTTGGATTGCGTATAGGCTCTATTTTCATTATACTTGCCTGCGCGACCTGTGGT
GCCCTATTCCCGGTAATCGCAAAGAGATCGTCTTGCCTGCACTTACCAAGATCAGCTTATGCGTTCGCCAAATAC
TTTGGATCGGGTGTCATTATCGCCACCGCATTCATACACTTACTTGATCCTGCAATAGAAGAACTTGGTTCTCCT
TGTCTTTCTGCAAAATGGGGCGAATATCCGTACGCACTTGCTTTGTGCATGCTCAGCATGTTCTGTGTCTTTCTC
GTGGAGCTCCTTGCCCTTCGGTGGGGCACAGCGAGGCTACGCAAATTAGGACTAGTACAAGCAGACCCCCATGGA
CATGGTGATGGAGGAAAACAGAAGGATCAAGAAGAAGCAAGGAGCGAATCCGATCTCGGGATCGATATTGCAGGC
AACTCCATAACAGAAAAAGTTTTAGCCCAGATTGTCGGAGTCGCCATTCTCGAGTTCGGTGTGGTGCTGCACAGT
ATATTGATTGGGCTCACACTTGCCGTGGATCAAAATTTCAAAATTTTGTTCATCGTTTTGATCTTCCATCAGTCA
TTCGAGGGTCTTGGACTCGGCTCTCGACTTGCACTGATGAAACTTGAACCCAAGTATCATTGGGTCCCATATGTC
GGTGCATTGGTCTACGGCATCACGACGCCTGTGGGAATAGCAGCCGGCCTTGGTGTTCGGACCACCTATAACCCG
GGAACTGCGAGTGCCAGTATCGTCAGCGGCGTCCTTGATGCCCTCAGCGCAGGGATTCTTCTATATACAGGACTT
GTGGAGCTACTTGCACATGAATTTTTATTTAACAAAGAAATGATGGAAAGCTCCGGTGGCAGGCTTGCCTTCGCT
GTCCTTGCAATGTTCCTCGGATGTGGTATAATGGCCCTTTTAGGCCGTTGGGCATAA
Transcript >Agabi119p4|091360
ATGAACCTGTTTCGGCTCAAATTAGCTCCACCGTTTGGCGATCCATCCATCATCTTCTTATACCCTTCTTGTGCC
ACGATGACTACTTTTGTGAACGCTCACCGCCATGTATTTCTACCGCGAGATGAAGATGAAGTGGACTGTAGTGAA
GGGGGAGGGGACGACCGATTTCTTGGATTGCGTATAGGCTCTATTTTCATTATACTTGCCTGCGCGACCTGTGGT
GCCCTATTCCCGGTAATCGCAAAGAGATCGTCTTGCCTGCACTTACCAAGATCAGCTTATGCGTTCGCCAAATAC
TTTGGATCGGGTGTCATTATCGCCACCGCATTCATACACTTACTTGATCCTGCAATAGAAGAACTTGGTTCTCCT
TGTCTTTCTGCAAAATGGGGCGAATATCCGTACGCACTTGCTTTGTGCATGCTCAGCATGTTCTGTGTCTTTCTC
GTGGAGCTCCTTGCCCTTCGGTGGGGCACAGCGAGGCTACGCAAATTAGGACTAGTACAAGCAGACCCCCATGGA
CATGGTGATGGAGGAAAACAGAAGGATCAAGAAGAAGCAAGGAGCGAATCCGATCTCGGGATCGATATTGCAGGC
AACTCCATAACAGAAAAAGTTTTAGCCCAGATTGTCGGAGTCGCCATTCTCGAGTTCGGTGTGGTGCTGCACAGT
ATATTGATTGGGCTCACACTTGCCGTGGATCAAAATTTCAAAATTTTGTTCATCGTTTTGATCTTCCATCAGTCA
TTCGAGGGTCTTGGACTCGGCTCTCGACTTGCACTGATGAAACTTGAACCCAAGTATCATTGGGTCCCATATGTC
GGTGCATTGGTCTACGGCATCACGACGCCTGTGGGAATAGCAGCCGGCCTTGGTGTTCGGACCACCTATAACCCG
GGAACTGCGAGTGCCAGTATCGTCAGCGGCGTCCTTGATGCCCTCAGCGCAGGGATTCTTCTATATACAGGACTT
GTGGAGCTACTTGCACATGAATTTTTATTTAACAAAGAAATGATGGAAAGCTCCGGTGGCAGGCTTGCCTTCGCT
GTCCTTGCAATGTTCCTCGGATGTGGTATAATGGCCCTTTTAGGCCGTTGGGCATAA
Gene >Agabi119p4|091360
ATGAACCTGTTTCGGCTCAAATTAGCTCCACCGGTACGGTACCCTTTAAACTCCCACCGAGTACCCTCACAGTCG
TCACACATACTTATACTCCAGTTTGGCGATCCATCCATCATCTTCTTATACCCTTCTTGTGCCACGATGACTACT
TTTGTGAACGCTCACCGCCATGTATTTCTACCGCGAGATGAAGATGAAGTGGACTGTAGTGAAGGGGGAGGGGAC
GACCGATTTCTTGGATTGCGTATAGGCTCTATTTTCATTATACTTGCCTGCGCGACCTGTGGTGCCCTATTCCCG
GTAATCGCAAAGAGATCGTCTTGCCTGCACTTACCAAGATCAGCTTATGCGTACGCACTTTTATTCCCTCTATCA
TCCCGCTGTACTGAACGGATTATTTTGTTCTAGGTTCGCCAAATACTTTGGATCGGGTGTCATTGTGAGTGATTT
TTTAAACAAATAAGAAGTGGATTTAACTTGTATGATGGAAGATCGCCACCGCATTCATACACTTACTTGATCCTG
CAATAGAAGAACTTGGTTCTCCTTGTCTTTCTGCAAAATGGGGCGAATATGTATGTCTCTATGCCGCATCAACGC
ACGATCACATACTCAGTTTACTATCTCAAAGCCGTACGCACTTGCTTTGTGCATGCTCAGCATGTTCTGTGTCTT
TCTCGTGGAGCTCCTTGCCCTTCGGTGGGGCACAGCGAGGCTACGCAAATTAGGACTAGTACAAGGTATGTCAAT
CGTATGGTCTTATCGCCTGAGCATCGAGTGGTACTCGGATTACGGTAGTTCCCACTCTAACTAAAATTTCTCCCT
ATATTCAGCAGACCCCCATGGACATGGTGATGGAGGAAAACAGAAGGATCAAGAAGAAGCAAGGAGCGAATCCGA
TCTCGGGATCGATATTGCAGGCAACTCCATAACAGAAAAAGTTTTAGCCCAGATTGTCGGAGTCGCCATTCTCGA
GTTCGGTGTGGTGCTGCACAGGTTCGCCAGATTATATCCCAACGAACGTGCCCTCATTTTTCTGATAGTATATTG
ATTGGGCTCACACTTGCCGTGGATCAAAATTTCAAAATTTTGTTCATCGTTTTGATCTTCCATCGTGGGTTATCA
TAACAGGCTATTCCCAACTAAACATATTTAACATCTACATAGAGTCATTCGAGGGTCTTGGACTCGGCTCTCGAC
TTGCACTGATGAAACTTGAACCCAAGTATCATTGGGTCCCATATGTCGGTGCATTGGTCTACGGCATCACGACGC
CTGTGGGAATAGCAGCCGGCCTTGGTGTTCGGACCACCTATAACCCGGGAACTGCGAGTGCCAGTATCGTCAGCG
GCGTCCTTGATGCCCTCAGCGCAGGGATTCTTCTATATACAGGACTTGTGGAGGTTCGTACTCCAATTGCCATAG
ACGCTTGTCGGGATGCTGACAGATTCTATGGTACAGCTACTTGCACATGAATTTTTATTTAACAAAGAAATGATG
GAAAGCTCCGGTGGCAGGCTTGCCTTCGCTGTCCTTGCAATGTTCCTCGGATGTGGTATAATGGCCCTTTTAGGC
CGTTGGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail